PTP4A1 (NM_003463) Human Recombinant Protein

PTP4A1 protein,

Product Info Summary

SKU: PROTQ93096
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PTP4A1 (NM_003463) Human Recombinant Protein

View all PTP4A1 recombinant proteins

SKU/Catalog Number

PROTQ93096

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human protein tyrosine phosphatase type IVA, member 1 (PTP4A1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PTP4A1 (NM_003463) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ93096)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.6 kDa

Amino Acid Sequence

MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ

Validation Images & Assay Conditions

Gene/Protein Information For PTP4A1 (Source: Uniprot.org, NCBI)

Gene Name

PTP4A1

Full Name

Protein tyrosine phosphatase type IVA 1

Weight

19.6 kDa

Superfamily

protein-tyrosine phosphatase family

Alternative Names

EC 3.1.3.48; HH72; PRL1; PRL-1; PRL-1DKFZp779M0721; Protein tyrosine phosphatase IVA1; protein tyrosine phosphatase type IVA 1; protein tyrosine phosphatase type IVA protein 1; protein tyrosine phosphatase type IVA, member 1; Protein-tyrosine phosphatase 4a1; Protein-tyrosine phosphatase of regenerating liver 1; PTP(CAAX1); PTP(CAAXI); PTPCAAX1PRL1PTP(CAAX1) PTP4A1 HH72, PRL-1, PRL1, PTP(CAAX1), PTPCAAX1 protein tyrosine phosphatase 4A1 protein tyrosine phosphatase type IVA 1|PVT1/PTP4A1 fusion|phosphatase of regenerating liver 1|protein tyrosine phosphatase type IVA protein 1|protein tyrosine phosphatase type IVA, member 1|protein-tyrosine phosphatase of regenerating liver 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PTP4A1, check out the PTP4A1 Infographic

PTP4A1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PTP4A1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ93096

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PTP4A1 (NM_003463) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PTP4A1 (NM_003463) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PTP4A1 (NM_003463) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ93096
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.