Prolactin (PRL) (NM_001163558) Human Recombinant Protein

Prolactin protein,

Product Info Summary

SKU: PROTP01236
Size: 20 µg
Source: HEK293T

Product Name

Prolactin (PRL) (NM_001163558) Human Recombinant Protein

View all Prolactin recombinant proteins

SKU/Catalog Number

PROTP01236

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human prolactin (PRL), transcript variant 2.

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Prolactin (PRL) (NM_001163558) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01236)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.8 kDa

Amino Acid Sequence

MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For PRL (Source: Uniprot.org, NCBI)

Gene Name

PRL

Full Name

Prolactin

Weight

22.8 kDa

Superfamily

somatotropin/prolactin family

Alternative Names

PRL; Prolactin PRL GHA1 prolactin prolactin|decidual prolactin|growth hormone A1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PRL, check out the PRL Infographic

PRL infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PRL: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP01236

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Prolactin (PRL) (NM_001163558) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Prolactin (PRL) (NM_001163558) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Prolactin (PRL) (NM_001163558) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP01236
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.