PPP3R2 (NM_147180) Human Recombinant Protein

PPP3R2 protein,

Product Info Summary

SKU: PROTQ96LZ3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PPP3R2 (NM_147180) Human Recombinant Protein

View all PPP3R2 recombinant proteins

SKU/Catalog Number

PROTQ96LZ3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform (PPP3R2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PPP3R2 (NM_147180) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96LZ3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.7 kDa

Amino Acid Sequence

MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV

Validation Images & Assay Conditions

Gene/Protein Information For PPP3R2 (Source: Uniprot.org, NCBI)

Gene Name

PPP3R2

Full Name

Calcineurin subunit B type 2

Weight

19.7 kDa

Superfamily

calcineurin regulatory subunit family

Alternative Names

calcineurin B, type II (19kDa); Calcineurin BII; Calcineurin B-like protein; calcineurin subunit B type 2; CBLP; CNBII; PPP3RL; Protein phosphatase 2B regulatory subunit 2; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), beta isoform(calcineurin B, type II); protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, beta isoform(calcineurin B, type II); protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform; Protein phosphatase 3 regulatory subunit B beta isoform; protein phosphatase 3, regulatory subunit B, beta PPP3R2 PPP3RL protein phosphatase 3 regulatory subunit B, beta calcineurin subunit B type 2|CBLP|CNBII|calcineurin B, type II (19kDa)|calcineurin B-like protein|calcineurin BII|protein phosphatase 2B regulatory subunit 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PPP3R2, check out the PPP3R2 Infographic

PPP3R2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PPP3R2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96LZ3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PPP3R2 (NM_147180) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PPP3R2 (NM_147180) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PPP3R2 (NM_147180) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96LZ3
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.