CLPP (NM_006012) Human Recombinant Protein

CLPP protein,

Product Info Summary

SKU: PROTQ16740
Size: 20 µg
Source: HEK293T

Product Name

CLPP (NM_006012) Human Recombinant Protein

View all CLPP recombinant proteins

SKU/Catalog Number

PROTQ16740

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli) (CLPP), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CLPP (NM_006012) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16740)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.1 kDa

Amino Acid Sequence

MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST

Validation Images & Assay Conditions

Gene/Protein Information For CLPP (Source: Uniprot.org, NCBI)

Gene Name

CLPP

Full Name

ATP-dependent Clp protease proteolytic subunit, mitochondrial

Weight

24.1 kDa

Superfamily

peptidase S14 family

Alternative Names

ATP-dependent protease ClpAP, proteolytic subunit, human; ClpP (caseinolytic protease, ATP-dependent, proteolytic subunit, E. coli)homolog; ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E.coli); ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog (E.coli); ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog; EC 3.4.21.92; Endopeptidase Clp; putative ATP-dependent Clp protease proteolytic subunit, mitochondrial CLPP DFNB81, PRLTS3 caseinolytic mitochondrial matrix peptidase proteolytic subunit ATP-dependent Clp protease proteolytic subunit, mitochondrial|ATP-dependent protease ClpAP, proteolytic subunit, human|ClpP caseinolytic peptidase ATP-dependent, proteolytic subunit|ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog|ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog|endopeptidase Clp|putative ATP-dependent Clp protease proteolytic subunit, mitochondrial

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CLPP, check out the CLPP Infographic

CLPP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CLPP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used CLPP (NM_006012) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CLPP (NM_006012) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CLPP (NM_006012) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ16740
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.