PP1C gamma (PPP1CC) (NM_002710) Human Recombinant Protein

Protein Phosphatase 1C gamma protein,

Product Info Summary

SKU: PROTP36873
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PP1C gamma (PPP1CC) (NM_002710) Human Recombinant Protein

View all Protein Phosphatase 1C gamma recombinant proteins

SKU/Catalog Number

PROTP36873

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human protein phosphatase 1, catalytic subunit, gamma isoform (PPP1CC)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PP1C gamma (PPP1CC) (NM_002710) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP36873)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.8 kDa

Amino Acid Sequence

MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK

Validation Images & Assay Conditions

Gene/Protein Information For PPP1CC (Source: Uniprot.org, NCBI)

Gene Name

PPP1CC

Full Name

Serine/threonine-protein phosphatase PP1-gamma catalytic subunit

Weight

36.8 kDa

Superfamily

PPP phosphatase family

Alternative Names

EC 3.1.3.16; PP-1G; PP1gamma; PPP1G; protein phosphatase 1, catalytic subunit, gamma isoform; protein phosphatase 1, catalytic subunit, gamma isozyme; Protein phosphatase 1C catalytic subunit; serine/threonine phosphatase 1 gamma; serine/threonine-protein phosphatase PP1-gamma catalytic subunit PPP1CC PP-1G, PP1C, PPP1G protein phosphatase 1 catalytic subunit gamma serine/threonine-protein phosphatase PP1-gamma catalytic subunit|protein phosphatase 1, catalytic subunit, gamma isozyme|protein phosphatase 1C catalytic subunit|serine/threonine phosphatase 1 gamma

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PPP1CC, check out the PPP1CC Infographic

PPP1CC infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PPP1CC: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP36873

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PP1C gamma (PPP1CC) (NM_002710) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PP1C gamma (PPP1CC) (NM_002710) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PP1C gamma (PPP1CC) (NM_002710) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP36873
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.