Neurokinin B (TAC3) (NM_013251) Human Recombinant Protein

Neurokinin B protein,

Product Info Summary

SKU: PROTQ9UHF0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Neurokinin B (TAC3) (NM_013251) Human Recombinant Protein

View all Neurokinin B recombinant proteins

SKU/Catalog Number

PROTQ9UHF0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tachykinin 3 (TAC3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Neurokinin B (TAC3) (NM_013251) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UHF0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.3 kDa

Amino Acid Sequence

MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE

Validation Images & Assay Conditions

Gene/Protein Information For TAC3 (Source: Uniprot.org, NCBI)

Gene Name

TAC3

Full Name

Tachykinin-3

Weight

13.3 kDa

Superfamily

tachykinin family

Alternative Names

gamma tachykinin 3; neurokinin beta; neurokinin B-like; neuromedin K; preprotachykinin B; PRO1155; tachykinin 3; tachykinin-3; ZNEUROK1NKNBNKB TAC3 HH10, LncZBTB39, NK3, NKB, NKNB, PRO1155, ZNEUROK1 tachykinin precursor 3 tachykinin-3|LncZBTB39-1:2|gamma tachykinin 3|neurokinin b|neuromedin K|preprotachykinin B|tachykinin 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TAC3, check out the TAC3 Infographic

TAC3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TAC3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UHF0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Neurokinin B (TAC3) (NM_013251) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Neurokinin B (TAC3) (NM_013251) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Neurokinin B (TAC3) (NM_013251) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UHF0
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product