Click image to see more details
Product Info Summary
| SKU: | PROTQ15165 |
|---|---|
| Size: | 2ug, 10ug, 1mg |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | ELISA, IP, WB |
Customers Who Bought This Also Bought
Product info
Product Name
PON2 Paraoxonase-2 Human Recombinant Protein
View all PON2 recombinant proteins
SKU/Catalog Number
PROTQ15165
Size
2ug, 10ug, 1mg
Description
Paraoxonase-2 Human Recombinant is expressed in E. coli having a molecular weight of 43.5 kDa and fused to an amino terminal hexahistidine tag. The PON2 purified by proprietary chromatographic techniques. Applications: Arylesterase 2 can be used directly as a positive control in Western blotting, ELISA, immunoprecipitation and other immunological experiments.
Storage & Handling
Store at 4°C if entire vial will be used within 1-2 weeks. Store frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles.
Cite This Product
PON2 Paraoxonase-2 Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15165)
Form
Sterile Filtered clear solution.
Formulation
PON2 is supplied in PBS and 50% glycerol.
Purity
Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.
Amino Acid Sequence
MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDID ILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNP HGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDIT AVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSAN GINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW VGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVY DGKLLIGTLYHRALYCELZ
Biological Activity
The biological activity of this product has not yet been tested.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For PON2 (Source: Uniprot.org, NCBI)
Gene Name
PON2
Full Name
Serum paraoxonase/arylesterase 2
Weight
Superfamily
paraoxonase family
Alternative Names
A-esterase 2; Aromatic esterase 2; EC 3.1.1.2; EC 3.1.1.81; paraoxonase 2; paraoxonase nirs; PON 2; PON2; Serum Aryldialkylphosphatase 2; serum paraoxonase/arylesterase 2 PON2 paraoxonase 2 serum paraoxonase/arylesterase 2|A-esterase 2|PON 2|aromatic esterase 2|arylesterase 2|paraoxonase nirs|serum aryldialkylphosphatase 2
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on PON2, check out the PON2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for PON2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For PON2 Paraoxonase-2 Human Recombinant Protein (PROTQ15165)
Hello CJ!
No publications found for PROTQ15165
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used PON2 Paraoxonase-2 Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For PON2 Paraoxonase-2 Human Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
