Click image to see more details
Product Info Summary
| SKU: | DZ01481 |
|---|---|
| Size: | 200 μl/vial |
| Reactive Species: | Zebrafish |
| Host: | Rabbit |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Zebrafish Ush2a Antibody
SKU/Catalog Number
DZ01481
Size
200 μl/vial
Form
Liquid
Description
Boster Bio Polyclonal Anti-Ush2a Antibody catalog # DZ01481. This antibody reacts with Zebrafish.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Zebrafish Ush2a Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # DZ01481)
Host
Rabbit
Contents
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Reactive Species
DZ01481 is reactive to ush2a in Zebrafish
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Calculated molecular weight
575.6kDa
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Validation Images & Assay Conditions
Click image to see more details
Figure 1. IF analysis of Ush2a using anti-Ush2a antibody (DZ01481).
Ush2a was detected in cryosections of wildtype zebrafish retina tissue without prior fixation. The tissue section was blocked with Blocking buffer (10% NGS, 2% BSA, 0.1% Tween in PBS) for 30 minutes. The tissue section was then incubated with rabbit anti-Ush2a Antibody (DZ01481) in blocking solution at 1:200 dilution overnight at 4°C. Alexa Fluor® 568 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody a and incubated for 1 hour at room temperature in blocking solution. Post immuno-fixation with 4% PFA in PBS for 10 minutes. Mount in Prolong gold.
Protein Target Info & Infographic
Gene/Protein Information For ush2a (Source: Uniprot.org, NCBI)
Gene Name
ush2a
Full Name
Usherin
Weight
575.6kDa
Alternative Names
Usherin USH2A RP39, US2, USH2, dJ1111A8.1 usherin usherin|Usher syndrome 2A (autosomal recessive, mild)|usher syndrome type IIa protein|usher syndrome type-2A protein
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ush2a, check out the ush2a Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ush2a: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Zebrafish Ush2a Antibody (DZ01481)
Hello CJ!
No publications found for DZ01481
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Zebrafish Ush2a Antibody?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
1 Reviews For Anti-Zebrafish Ush2a Antibody
0
Thank you for all the work on this project
Excellent
| Application | Immunofluorescence |
|---|---|
| Sample | wildtype and KO mutant zebrafish retina |
| Primary Incubation | 1:200 |
| Blocking Agent | 10% NGS, 2% BSA, 0.1% Tween in PBS |
| Secondary Antibody | Alexa Fluor® 568 Conjugated Goat Anti-Rabbit IgG |
"First, we received our shipment of antibodies in perfect condition. Thank you for all the work on this project. On the left, you can find pictures of 5dpf wildtype and Ush2a mutant zebrafish retina stained with DZ01481 in red. The pictures show the typical layered retinal structure, with punctate Ush2a staining at the connecting cilium (cc). In blue, the nuclei of inner and outer nuclear layers are shown (INL/ONL)."
Erik de Vrieze
Verified customer
Submitted 2024-09-27
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
1 Customer Q&As for Anti-Zebrafish Ush2a Antibody
Question
Can you send me the immunology of this antibody?
Verified customer
Asked: 2022-09-30
Answer
The immunogen sequence for DZ01481 is listed below. MGLVLKRALSKPPFIRERPPIMPLQRRSTKYPPKDSYLFDNIADSSCSITLKRFAMRTEGLTDTKIGGTCTSNHSYQASMSVLRVPSQSQLSHAYSQNSLHRSVSQLIDTQDKKSWDADLHATDSGMYVGDEDFGETIKSYSSVKKEQTMFTDTHL
Boster Scientific Support
Answered: 2022-09-30
