POLD4 (NM_021173) Human Recombinant Protein

POLD4 protein,

Product Info Summary

SKU: PROTQ9HCU8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

POLD4 (NM_021173) Human Recombinant Protein

View all POLD4 recombinant proteins

SKU/Catalog Number

PROTQ9HCU8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human polymerase (DNA-directed), delta 4 (POLD4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

POLD4 (NM_021173) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9HCU8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.3 kDa

Amino Acid Sequence

MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRWCRAKHMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL

Validation Images & Assay Conditions

Gene/Protein Information For POLD4 (Source: Uniprot.org, NCBI)

Gene Name

POLD4

Full Name

DNA polymerase delta subunit 4

Weight

12.3 kDa

Superfamily

DNA polymerase delta subunit 4 family

Alternative Names

DNA polymerase delta smallest subunit p12; DNA polymerase delta subunit p12; p12; POLDSDNA polymerase delta subunit 4; polymerase (DNA-directed), delta 4 POLD4 POLDS, p12 DNA polymerase delta 4, accessory subunit DNA polymerase delta subunit 4|DNA polymerase delta smallest subunit p12|polymerase (DNA) delta 4, accessory subunit|polymerase (DNA-directed), delta 4, accessory subunit

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on POLD4, check out the POLD4 Infographic

POLD4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for POLD4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9HCU8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used POLD4 (NM_021173) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For POLD4 (NM_021173) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for POLD4 (NM_021173) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9HCU8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.