Methyltransferase like 6 (METTL6) (NM_152396) Human Recombinant Protein

Methyltransferase like 6 protein,

Recombinant protein of human methyltransferase like 6 (METTL6)

Product Info Summary

SKU: PROTQ8TCB7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Methyltransferase like 6 (METTL6) (NM_152396) Human Recombinant Protein

View all Methyltransferase like 6 recombinant proteins

SKU/Catalog Number

PROTQ8TCB7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human methyltransferase like 6 (METTL6)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Methyltransferase like 6 (METTL6) (NM_152396) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8TCB7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.1 kDa

Amino Acid Sequence

MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVNKKEGLCVPRVFLQSKFLKPPKNPSPVVLGLDPKS

Validation Images & Assay Conditions

Gene/Protein Information For METTL6 (Source: Uniprot.org, NCBI)

Gene Name

METTL6

Full Name

tRNA N(3)-methylcytidine methyltransferase METTL6

Weight

33.1 kDa

Superfamily

methyltransferase superfamily

Alternative Names

EC 2.1.1; EC 2.1.1.-; EC 2.1.1.41; methyltransferase like 6; methyltransferase-like protein 6; MGC24132

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on METTL6, check out the METTL6 Infographic

METTL6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for METTL6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8TCB7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Methyltransferase like 6 (METTL6) (NM_152396) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Methyltransferase like 6 (METTL6) (NM_152396) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Methyltransferase like 6 (METTL6) (NM_152396) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8TCB7
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.