Plasma Kallikrein 1B (KLKB1) (NM_000892) Human Recombinant Protein

Plasma Kallikrein/KLKB1 protein,

Recombinant protein of human kallikrein B, plasma (Fletcher factor) 1 (KLKB1)

Product Info Summary

SKU: PROTP03952
Size: 20 µg
Source: HEK293T

Product Name

Plasma Kallikrein 1B (KLKB1) (NM_000892) Human Recombinant Protein

View all Plasma Kallikrein/KLKB1 recombinant proteins

SKU/Catalog Number

PROTP03952

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human kallikrein B, plasma (Fletcher factor) 1 (KLKB1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Plasma Kallikrein 1B (KLKB1) (NM_000892) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP03952)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

41.3 kDa

Amino Acid Sequence

MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA

Validation Images & Assay Conditions

Gene/Protein Information For KLKB1 (Source: Uniprot.org, NCBI)

Gene Name

KLKB1

Full Name

Plasma kallikrein

Weight

41.3 kDa

Superfamily

peptidase S1 family

Alternative Names

EC 3.4.21; EC 3.4.21.34; Fletcher factor; kallikrein B, plasma (Fletcher factor) 1; kininogenin; KLK3plasma kallikrein; KLKB1; plasma kallikrein heavy chain; plasma kallikrein light chain; Plasma Kallikrein; Plasma Prekallikrein; PPK KLKB1 KLK3, PKK, PKKD, PPK kallikrein B1 plasma kallikrein|kallikrein B, plasma (Fletcher factor) 1|kininogenin|plasma prekallikrein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KLKB1, check out the KLKB1 Infographic

KLKB1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KLKB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP03952

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Plasma Kallikrein 1B (KLKB1) (NM_000892) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Plasma Kallikrein 1B (KLKB1) (NM_000892) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Plasma Kallikrein 1B (KLKB1) (NM_000892) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP03952
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product