PLAC9 (NM_001012973) Human Recombinant Protein

PLAC9 protein,

Recombinant protein of human placenta-specific 9 (PLAC9)

Product Info Summary

SKU: PROTQ5JTB6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PLAC9 (NM_001012973) Human Recombinant Protein

View all PLAC9 recombinant proteins

SKU/Catalog Number

PROTQ5JTB6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human placenta-specific 9 (PLAC9)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PLAC9 (NM_001012973) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ5JTB6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

10.1 kDa

Amino Acid Sequence

MRPLLCALTGLALLRAAGSLAAAEPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF

Validation Images & Assay Conditions

Gene/Protein Information For PLAC9 (Source: Uniprot.org, NCBI)

Gene Name

PLAC9

Full Name

Placenta-specific protein 9

Weight

10.1 kDa

Superfamily

PLAC9 family

Alternative Names

MGC104710; placenta-specific 9; placenta-specific protein 9 PLAC9 placenta associated 9 placenta-specific protein 9|placenta specific 9

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PLAC9, check out the PLAC9 Infographic

PLAC9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PLAC9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ5JTB6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PLAC9 (NM_001012973) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PLAC9 (NM_001012973) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PLAC9 (NM_001012973) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ5JTB6
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product