PI4K2A (NM_018425) Human Recombinant Protein

PI4K2A protein,

Recombinant protein of human phosphatidylinositol 4-kinase type 2 alpha (PI4K2A)

Product Info Summary

SKU: PROTQ9BTU6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PI4K2A (NM_018425) Human Recombinant Protein

View all PI4K2A recombinant proteins

SKU/Catalog Number

PROTQ9BTU6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phosphatidylinositol 4-kinase type 2 alpha (PI4K2A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PI4K2A (NM_018425) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BTU6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

53.8 kDa

Amino Acid Sequence

MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQPLLDRARGAAAQGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELAIERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW

Validation Images & Assay Conditions

Gene/Protein Information For PI4K2A (Source: Uniprot.org, NCBI)

Gene Name

PI4K2A

Full Name

Phosphatidylinositol 4-kinase type 2-alpha

Weight

53.8 kDa

Superfamily

PI3/PI4-kinase family

Alternative Names

DKFZp761G1923; EC 2.7.1.67; phosphatidylinositol 4-kinase type 2 alpha; phosphatidylinositol 4-kinase type 2-alpha; phosphatidylinositol 4-kinase type II (PI4KII); Phosphatidylinositol 4-kinase type II-alpha; PI4KII; PIK42A; RP11-548K23.6 PI4K2A PI4KII, PIK42A phosphatidylinositol 4-kinase type 2 alpha phosphatidylinositol 4-kinase type 2-alpha|phosphatidylinositol 4-kinase type II (PI4KII)|phosphatidylinositol 4-kinase type II-alpha

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PI4K2A, check out the PI4K2A Infographic

PI4K2A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PI4K2A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BTU6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PI4K2A (NM_018425) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PI4K2A (NM_018425) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PI4K2A (NM_018425) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BTU6
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.