PDI (PDIA2) (NM_006849) Human Recombinant Protein

PDI protein,

Recombinant protein of human protein disulfide isomerase family A, member 2 (PDIA2)

Product Info Summary

SKU: PROTQ13087
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PDI (PDIA2) (NM_006849) Human Recombinant Protein

View all PDI recombinant proteins

SKU/Catalog Number

PROTQ13087

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human protein disulfide isomerase family A, member 2 (PDIA2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PDI (PDIA2) (NM_006849) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13087)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

58 kDa

Amino Acid Sequence

MSRQLLPVLLLLLLRASCPWGQEQGARSPSEEPPEEEIPKEDGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTVVLFKKFDEGRADFPVDEELGLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRLVNLETTKKYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLDNGGVLPTEEPPEEPAAPFPEPPANSTMGSKEEL

Validation Images & Assay Conditions

Gene/Protein Information For PDIA2 (Source: Uniprot.org, NCBI)

Gene Name

PDIA2

Full Name

Protein disulfide-isomerase A2

Weight

58 kDa

Superfamily

protein disulfide isomerase family

Alternative Names

Pancreas-specific protein disulfide isomerase; pancreatic protein disulfide isomerase; PDA2; PDI; PDIp; PDIPEC 5.3.4.1; PDIR; protein disulfide isomerase A2; protein disulfide isomerase family A, member 2; protein disulfide isomerase, pancreatic; protein disulfide isomerase-associated 2; protein disulfide-isomerase A2; Rho GDP dissociation inhibitor gamma PDIA2 PDA2, PDI, PDIP, PDIR protein disulfide isomerase family A member 2 protein disulfide-isomerase A2|Rho GDP dissociation inhibitor gamma|pancreas-specific protein disulfide isomerase|pancreatic protein disulfide isomerase|protein disulfide isomerase, pancreatic|protein disulfide isomerase-associated 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PDIA2, check out the PDIA2 Infographic

PDIA2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PDIA2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13087

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PDI (PDIA2) (NM_006849) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PDI (PDIA2) (NM_006849) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PDI (PDIA2) (NM_006849) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13087
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.