PBP (PEBP1) (NM_002567) Human Recombinant Protein

RKIP/PBP protein,

Product Info Summary

SKU: PROTP30086
Size: 20 µg
Source: HEK293T

Product Name

PBP (PEBP1) (NM_002567) Human Recombinant Protein

View all RKIP/PBP recombinant proteins

SKU/Catalog Number

PROTP30086

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phosphatidylethanolamine binding protein 1 (PEBP1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PBP (PEBP1) (NM_002567) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP30086)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.9 kDa

Amino Acid Sequence

MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

Validation Images & Assay Conditions

Gene/Protein Information For PEBP1 (Source: Uniprot.org, NCBI)

Gene Name

PEBP1

Full Name

Phosphatidylethanolamine-binding protein 1

Weight

20.9 kDa

Superfamily

phosphatidylethanolamine-binding protein family

Alternative Names

HCNP; HCNPpp; hippocampal cholinergic neurostimulating peptide; Neuropolypeptide h3; PBP; PBPPEBP-1; PEBP1; PEBP-1; PEBPHCNPpp; phosphatidylethanolamine binding protein 1; phosphatidylethanolamine-binding protein 1; prostatic binding protein; Prostatic-binding protein; Raf kinase inhibitory protein; RKIP; RKIPRaf kinase inhibitor protein PEBP1 HCNP, HCNPpp, HEL-210, HEL-S-34, HEL-S-96, PBP, PEBP, PEBP-1, RKIP phosphatidylethanolamine binding protein 1 phosphatidylethanolamine-binding protein 1|Raf kinase inhibitory protein|epididymis luminal protein 210|epididymis secretory protein Li 34|epididymis secretory protein Li 96|hippocampal cholinergic neurostimulating peptide|neuropolypeptide h3|prostatic binding protein|raf kinase inhibitor protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PEBP1, check out the PEBP1 Infographic

PEBP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PEBP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used PBP (PEBP1) (NM_002567) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PBP (PEBP1) (NM_002567) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PBP (PEBP1) (NM_002567) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP30086
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.