PAR4 (PAWR) (NM_002583) Human Recombinant Protein

Pawr protein,

Recombinant protein of human PRKC, apoptosis, WT1, regulator (PAWR)

Product Info Summary

SKU: PROTQ96IZ0
Size: 20 µg
Source: HEK293T

Product Name

PAR4 (PAWR) (NM_002583) Human Recombinant Protein

View all Pawr recombinant proteins

SKU/Catalog Number

PROTQ96IZ0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human PRKC, apoptosis, WT1, regulator (PAWR)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PAR4 (PAWR) (NM_002583) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96IZ0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.4 kDa

Amino Acid Sequence

MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR

Validation Images & Assay Conditions

Gene/Protein Information For PAWR (Source: Uniprot.org, NCBI)

Gene Name

PAWR

Full Name

PRKC apoptosis WT1 regulator protein

Weight

36.4 kDa

Alternative Names

Par-4; PAR4prostate apoptosis response protein 4; PRKC apoptosis WT1 regulator protein; PRKC, apoptosis, WT1, regulator; Prostate apoptosis response 4 protein; prostate apoptosis response protein PAR-4; transcriptional repressor PAR4; WT1-interacting protein PAWR PAR4, Par-4 pro-apoptotic WT1 regulator PRKC apoptosis WT1 regulator protein|PRKC, apoptosis, WT1, regulator|WT1-interacting protein|prostate apoptosis response protein 4|prostate apoptosis response protein PAR-4|prostate apoptosis response-4|transcriptional repressor PAR4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PAWR, check out the PAWR Infographic

PAWR infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PAWR: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96IZ0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PAR4 (PAWR) (NM_002583) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PAR4 (PAWR) (NM_002583) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PAR4 (PAWR) (NM_002583) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96IZ0
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.