OCIAD1 (NM_017830) Human Recombinant Protein

OCIAD1 protein,

Recombinant protein of human OCIA domain containing 1 (OCIAD1), transcript variant 1

Product Info Summary

SKU: PROTQ9NX40
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

OCIAD1 (NM_017830) Human Recombinant Protein

View all OCIAD1 recombinant proteins

SKU/Catalog Number

PROTQ9NX40

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human OCIA domain containing 1 (OCIAD1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

OCIAD1 (NM_017830) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NX40)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.4 kDa

Amino Acid Sequence

MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE

Validation Images & Assay Conditions

Gene/Protein Information For OCIAD1 (Source: Uniprot.org, NCBI)

Gene Name

OCIAD1

Full Name

OCIA domain-containing protein 1

Weight

27.4 kDa

Superfamily

OCIAD1 family

Alternative Names

Asrij; MGC111072; OCIA domain containing 1; OCIA domain-containing protein 1; OCIAFLJ20455; Ovarian carcinoma immunoreactive antigen; TPA018 OCIAD1 ASRIJ, OCIA, TPA018 OCIA domain containing 1 OCIA domain-containing protein 1|ovarian cancer immunoreactive domain containing 1|ovarian cancer immunoreactive domain containing 1A|ovarian carcinoma immunoreactive

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on OCIAD1, check out the OCIAD1 Infographic

OCIAD1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for OCIAD1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NX40

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used OCIAD1 (NM_017830) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For OCIAD1 (NM_017830) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for OCIAD1 (NM_017830) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NX40
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product