NME2 (NM_001018139) Human Recombinant Protein

NM23-H2/NME2 protein,

Product Info Summary

SKU: PROTP22392
Size: 20 µg
Source: HEK293T

Product Name

NME2 (NM_001018139) Human Recombinant Protein

View all NM23-H2/NME2 recombinant proteins

SKU/Catalog Number

PROTP22392

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 4

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NME2 (NM_001018139) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP22392)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.1 kDa

Amino Acid Sequence

MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

Validation Images & Assay Conditions

Gene/Protein Information For NME2 (Source: Uniprot.org, NCBI)

Gene Name

NME2

Full Name

Nucleoside diphosphate kinase B

Weight

17.1 kDa

Superfamily

NDK family

Alternative Names

EC 2.7.13.3; Histidine protein kinase NDKB; MGC2212; NDK B; NDKB; NDP Kinase B2; NDPKB; NDPK-B; NM23B; NM23-H2; NME2; non-metastatic cells 2, protein (NM23B) expressed in; nucleoside diphosphate kinase B; protein (NM23) expressed in NME2 NDKB, NDPK-B, NDPKB, NM23-H2, NM23B, PUF NME/NM23 nucleoside diphosphate kinase 2 nucleoside diphosphate kinase B|HEL-S-155an|NDP kinase B|c-myc purine-binding transcription factor PUF|c-myc transcription factor|epididymis secretory sperm binding protein Li 155an|histidine protein kinase NDKB|non-metastatic cells 2, protein (NM23) expressed in|non-metastatic cells 2, protein (NM23B) expressed in|nucleotide diphosphate kinase B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NME2, check out the NME2 Infographic

NME2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NME2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP22392

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NME2 (NM_001018139) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NME2 (NM_001018139) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NME2 (NM_001018139) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP22392
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.