NKX2.8 (NKX2-8) (NM_014360) Human Recombinant Protein

NKX2.8 protein,

Recombinant protein of human NK2 homeobox 8 (NKX2-8)

Product Info Summary

SKU: PROTO15522
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NKX2.8 (NKX2-8) (NM_014360) Human Recombinant Protein

View all NKX2.8 recombinant proteins

SKU/Catalog Number

PROTO15522

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human NK2 homeobox 8 (NKX2-8)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NKX2.8 (NKX2-8) (NM_014360) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15522)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.7 kDa

Amino Acid Sequence

MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQRPSARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLKRARAPGAAESPDLAASAELHAAPGLLRRVVVPVLVRDGQPCGGGGGGEVGTAAAQEKCGAPPAAACPLPGYPAFGPGSALGLFPAYQHLASPALVSWNW

Validation Images & Assay Conditions

Gene/Protein Information For NKX2-8 (Source: Uniprot.org, NCBI)

Gene Name

NKX2-8

Full Name

Homeobox protein Nkx-2.8

Weight

25.7 kDa

Superfamily

NK-2 homeobox family

Alternative Names

Homeobox protein NK-2 homolog H; homeobox protein Nkx-2.8; NK2 homeobox 8; NK-2 homolog H (Drosophila); NK2 transcription factor related, locus 8 (Drosophila); NK2 transcription factor related, locus 8; NKX-2.8; NKX2.8NK-2 homolog 8; Nkx2-9; NKX2G; NKX2HNK-2 homolog H NKX2-8 NKX2.8, NKX2H, Nkx2-9 NK2 homeobox 8 homeobox protein Nkx-2.8|NK-2 homolog 8|NK-2 homolog H|NK2 transcription factor related, locus 8|homeobox protein NK-2 homolog H

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NKX2-8, check out the NKX2-8 Infographic

NKX2-8 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NKX2-8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO15522

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NKX2.8 (NKX2-8) (NM_014360) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NKX2.8 (NKX2-8) (NM_014360) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NKX2.8 (NKX2-8) (NM_014360) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO15522
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.