NKIRAS2 (NM_017595) Human Recombinant Protein

NKIRAS2 protein,

Product Info Summary

SKU: PROTQ9NYR9
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NKIRAS2 (NM_017595) Human Recombinant Protein

View all NKIRAS2 recombinant proteins

SKU/Catalog Number

PROTQ9NYR9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NKIRAS2 (NM_017595) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NYR9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.3 kDa

Amino Acid Sequence

MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG

Validation Images & Assay Conditions

Gene/Protein Information For NKIRAS2 (Source: Uniprot.org, NCBI)

Gene Name

NKIRAS2

Full Name

NF-kappa-B inhibitor-interacting Ras-like protein 2

Weight

21.3 kDa

Superfamily

small GTPase superfamily

Alternative Names

DKFZP434N1526; I-kappa-B-interacting Ras-like protein 2; Kappa B-Ras protein 2; kappaB-Ras2; KBRAS2DKFZp434N1526; MGC74742; NF-kappa-B inhibitor-interacting Ras-like protein 2; NFKB inhibitor interacting Ras-like 2; NFKB inhibitor interacting Ras-like protein 2 NKIRAS2 KBRAS2, kappaB-Ras2 NFKB inhibitor interacting Ras like 2 NF-kappa-B inhibitor-interacting Ras-like protein 2|I-kappa-B-interacting Ras-like protein 2|NFKB inhibitor interacting Ras-like protein 2|kappa B-Ras protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NKIRAS2, check out the NKIRAS2 Infographic

NKIRAS2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NKIRAS2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NYR9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NKIRAS2 (NM_017595) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NKIRAS2 (NM_017595) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NKIRAS2 (NM_017595) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NYR9
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.