NHLH1 (NM_005598) Human Recombinant Protein

NHLH1 protein,

Product Info Summary

SKU: PROTQ02575
Size: 20 µg
Source: HEK293T

Product Name

NHLH1 (NM_005598) Human Recombinant Protein

View all NHLH1 recombinant proteins

SKU/Catalog Number

PROTQ02575

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nescient helix loop helix 1 (NHLH1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NHLH1 (NM_005598) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ02575)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.4 kDa

Amino Acid Sequence

MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV

Validation Images & Assay Conditions

Gene/Protein Information For NHLH1 (Source: Uniprot.org, NCBI)

Gene Name

NHLH1

Full Name

Helix-loop-helix protein 1

Weight

14.4 kDa

Alternative Names

BHLHA35; bHLHa35HEN-1; helix-loop-helix protein 1; HEN1NSCL-1; nescient helix loop helix 1Class A basic helix-loop-helix protein 35; NSCL; NSCL1 NHLH1 HEN1, NSCL, NSCL1, bHLHa35 nescient helix-loop-helix 1 helix-loop-helix protein 1|HEN-1|NSCL-1|class A basic helix-loop-helix protein 35

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NHLH1, check out the NHLH1 Infographic

NHLH1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NHLH1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ02575

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NHLH1 (NM_005598) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NHLH1 (NM_005598) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NHLH1 (NM_005598) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ02575
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.