NEK6 (NM_014397) Human Recombinant Protein

NEK6 protein,

Recombinant protein of human NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 2

Product Info Summary

SKU: PROTQ9HC98
Size: 20 µg
Source: HEK293T

Product Name

NEK6 (NM_014397) Human Recombinant Protein

View all NEK6 recombinant proteins

SKU/Catalog Number

PROTQ9HC98

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NEK6 (NM_014397) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9HC98)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35.5 kDa

Amino Acid Sequence

MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST

Validation Images & Assay Conditions

Gene/Protein Information For NEK6 (Source: Uniprot.org, NCBI)

Gene Name

NEK6

Full Name

Serine/threonine-protein kinase Nek6

Weight

35.5 kDa

Superfamily

protein kinase superfamily

Alternative Names

EC 2.7.11.1; Never in mitosis A-related kinase 6; NIMA (never in mitosis gene a)-related kinase 6; NimA-related protein kinase 6; Protein kinase SID6-1512; putative serine-threonine protein kinase; serine/threonine-protein kinase Nek6; SID6-1512 NEK6 SID6-1512 NIMA related kinase 6 serine/threonine-protein kinase Nek6|NIMA (never in mitosis gene a)-related kinase 6|never in mitosis A-related kinase 6|nimA-related protein kinase 6|protein kinase SID6-1512|putative serine-threonine protein kinase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NEK6, check out the NEK6 Infographic

NEK6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NEK6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9HC98

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NEK6 (NM_014397) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NEK6 (NM_014397) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NEK6 (NM_014397) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9HC98
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.