NCF4 (NM_000631) Human Recombinant Protein

NCF4 protein,

Product Info Summary

SKU: PROTQ15080
Size: 20 µg
Source: HEK293T

Product Name

NCF4 (NM_000631) Human Recombinant Protein

View all NCF4 recombinant proteins

SKU/Catalog Number

PROTQ15080

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NCF4 (NM_000631) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15080)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

38.9 kDa

Amino Acid Sequence

MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP

Validation Images & Assay Conditions

Gene/Protein Information For NCF4 (Source: Uniprot.org, NCBI)

Gene Name

NCF4

Full Name

Neutrophil cytosol factor 4

Weight

38.9 kDa

Alternative Names

MGC3810; NCF; NCF-4; neutrophil cytosol factor 4; neutrophil cytosolic factor 4 (40kD); neutrophil cytosolic factor 4, 40kDa; Neutrophil NADPH oxidase factor 4; p40phox; p40-phox; SH3 and PX domain-containing protein 4; SH3PXD4P40PHOX NCF4 CGD3, NCF, P40PHOX, SH3PXD4 neutrophil cytosolic factor 4 neutrophil cytosol factor 4|NCF-4|SH3 and PX domain-containing protein 4|neutrophil NADPH oxidase factor 4|neutrophil cytosolic factor 4, 40kDa|p40-phox

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NCF4, check out the NCF4 Infographic

NCF4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NCF4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ15080

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NCF4 (NM_000631) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NCF4 (NM_000631) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NCF4 (NM_000631) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ15080
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.