NANOS2 (NM_001029861) Human Recombinant Protein

NANOS2 protein,

Recombinant protein of human nanos homolog 2 (Drosophila) (NANOS2)

Product Info Summary

SKU: PROTP60321
Size: 20 µg
Source: HEK293T

Product Name

NANOS2 (NM_001029861) Human Recombinant Protein

View all NANOS2 recombinant proteins

SKU/Catalog Number

PROTP60321

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nanos homolog 2 (Drosophila) (NANOS2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NANOS2 (NM_001029861) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP60321)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15 kDa

Amino Acid Sequence

MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR

Validation Images & Assay Conditions

Gene/Protein Information For NANOS2 (Source: Uniprot.org, NCBI)

Gene Name

NANOS2

Full Name

Nanos homolog 2

Weight

15 kDa

Superfamily

nanos family

Alternative Names

nanos homolog 2 (Drosophila); nanos homolog 2; Nanos2; NOS2NOS-2 NANOS2 NOS2, ZC2HC12B nanos C2HC-type zinc finger 2 nanos homolog 2|NOS-2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NANOS2, check out the NANOS2 Infographic

NANOS2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NANOS2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP60321

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NANOS2 (NM_001029861) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NANOS2 (NM_001029861) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NANOS2 (NM_001029861) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP60321
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product