Myosin (MYL4) (NM_002476) Human Recombinant Protein

MYL4 protein,

Product Info Summary

SKU: PROTP12829
Size: 20 µg
Source: HEK293T

Product Name

Myosin (MYL4) (NM_002476) Human Recombinant Protein

View all MYL4 recombinant proteins

SKU/Catalog Number

PROTP12829

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human myosin, light chain 4, alkali; atrial, embryonic (MYL4), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Myosin (MYL4) (NM_002476) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP12829)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.4 kDa

Amino Acid Sequence

MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG

Validation Images & Assay Conditions

Gene/Protein Information For MYL4 (Source: Uniprot.org, NCBI)

Gene Name

MYL4

Full Name

Myosin light chain 4

Weight

21.4 kDa

Alternative Names

ALC1; AMLC; GT1; MLC1; Myosin light chain 1, embryonic muscle/atrial isoform; myosin light chain 4; Myosin light chain alkali GT-1 isoform; myosin, atrial/fetal muscle, light chain; myosin, light chain 4, alkali; atrial, embryonic; myosin, light polypeptide 4, alkali; atrial, embryonic; PRO1957 MYL4 ALC1, AMLC, GT1, PRO1957 myosin light chain 4 myosin light chain 4|atrial myosin light chain 1|myosin, atrial/fetal muscle, light chain|myosin, light chain 4, alkali; atrial, embryonic|myosin, light polypeptide 4, alkali; atrial, embryonic

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MYL4, check out the MYL4 Infographic

MYL4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MYL4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used Myosin (MYL4) (NM_002476) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Myosin (MYL4) (NM_002476) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Myosin (MYL4) (NM_002476) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP12829
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.