MSX1 (NM_002448) Human Recombinant Protein

MSX1 protein,

Recombinant protein of human msh homeobox 1 (MSX1)

Product Info Summary

SKU: PROTP28360
Size: 20 µg
Source: HEK293T

Product Name

MSX1 (NM_002448) Human Recombinant Protein

View all MSX1 recombinant proteins

SKU/Catalog Number

PROTP28360

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human msh homeobox 1 (MSX1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MSX1 (NM_002448) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP28360)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

31.3 kDa

Amino Acid Sequence

MAPAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT

Validation Images & Assay Conditions

Gene/Protein Information For MSX1 (Source: Uniprot.org, NCBI)

Gene Name

MSX1

Full Name

Homeobox protein MSX-1

Weight

31.3 kDa

Superfamily

Msh homeobox family

Alternative Names

Homeobox protein Hox-7; homeobox protein MSX-1; HOX7; HOX7homeobox 7; HYD1; HYD1msh homeobox homolog 1 (Drosophila); msh (Drosophila) homeo box homolog 1 (formerly homeo box 7); msh homeo box 1; msh homeobox 1; Msh homeobox 1-like protein; msh homeobox homolog 1; MSX1; OFC5; STHAG1 MSX1 ECTD3, HOX7, HYD1, STHAG1 msh homeobox 1 homeobox protein MSX-1|homeobox 7|homeobox protein Hox-7|msh homeo box 1|msh homeobox 1-like protein|msh homeobox homolog 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MSX1, check out the MSX1 Infographic

MSX1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MSX1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP28360

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MSX1 (NM_002448) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MSX1 (NM_002448) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MSX1 (NM_002448) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP28360
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.