MST3 (STK24) (NM_003576) Human Recombinant Protein

MST3 protein,

Recombinant protein of human serine/threonine kinase 24 (STE20 homolog, yeast) (STK24), transcript variant 1

Product Info Summary

SKU: PROTQ9Y6E0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MST3 (STK24) (NM_003576) Human Recombinant Protein

View all MST3 recombinant proteins

SKU/Catalog Number

PROTQ9Y6E0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human serine/threonine kinase 24 (STE20 homolog, yeast) (STK24), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MST3 (STK24) (NM_003576) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y6E0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

49.1 kDa

Amino Acid Sequence

MDSRAQLWGLALNKRRATLPHPGGSTNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQLAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH

Validation Images & Assay Conditions

Gene/Protein Information For STK24 (Source: Uniprot.org, NCBI)

Gene Name

STK24

Full Name

Serine/threonine-protein kinase 24

Weight

49.1 kDa

Superfamily

protein kinase superfamily

Alternative Names

EC 2.7.11; EC 2.7.11.1; Mammalian STE20-like protein kinase 3; MST-3; MST3serine/threonine kinase 24 (Ste20, yeast homolog); serine/threonine kinase 24; serine/threonine-protein kinase 24; STE20; STE20-like kinase 3; STE20-like kinase MST3; sterile 20-like kinase 3; STK3yeast) STK24 HEL-S-95, MST3, MST3B, STE20, STK3 serine/threonine kinase 24 serine/threonine-protein kinase 24|STE20-like kinase 3|STE20-like kinase MST3|epididymis secretory protein Li 95|mammalian STE20-like protein kinase 3|serine/threonine kinase 24 (STE20 homolog, yeast)|sterile 20-like kinase 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on STK24, check out the STK24 Infographic

STK24 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for STK24: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y6E0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MST3 (STK24) (NM_003576) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MST3 (STK24) (NM_003576) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MST3 (STK24) (NM_003576) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y6E0
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.