COPS8 (NM_198189) Human Recombinant Protein

COPS8 protein,

Product Info Summary

SKU: PROTQ99627
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

COPS8 (NM_198189) Human Recombinant Protein

View all COPS8 recombinant proteins

SKU/Catalog Number

PROTQ99627

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis) (COPS8), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

COPS8 (NM_198189) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99627)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.7 kDa

Amino Acid Sequence

MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN

Validation Images & Assay Conditions

Gene/Protein Information For COPS8 (Source: Uniprot.org, NCBI)

Gene Name

COPS8

Full Name

COP9 signalosome complex subunit 8

Weight

17.7 kDa

Superfamily

CSN8 family

Alternative Names

COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis); COP9 homolog; COP9 signalosome complex subunit 8; COP9; CSN8JAB1-containing signalosome subunit 8; hCOP9; MGC1297; MMMEP; SGN8MGC43256; Signalosome subunit 8 COPS8 COP9, CSN8, SGN8 COP9 signalosome subunit 8 COP9 signalosome complex subunit 8|COP9 constitutive photomorphogenic homolog subunit 8|COP9 homolog|JAB1-containing signalosome subunit 8|hCOP9|signalosome subunit 8

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on COPS8, check out the COPS8 Infographic

COPS8 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for COPS8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ99627

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used COPS8 (NM_198189) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For COPS8 (NM_198189) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for COPS8 (NM_198189) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ99627
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.