MRPS18B (NM_014046) Human Recombinant Protein

MRPS18B protein,

Recombinant protein of human mitochondrial ribosomal protein S18B (MRPS18B), nuclear gene encoding mitochondrial protein

Product Info Summary

SKU: PROTQ9Y676
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MRPS18B (NM_014046) Human Recombinant Protein

View all MRPS18B recombinant proteins

SKU/Catalog Number

PROTQ9Y676

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mitochondrial ribosomal protein S18B (MRPS18B), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MRPS18B (NM_014046) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y676)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

29.2 kDa

Amino Acid Sequence

MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSSDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL

Validation Images & Assay Conditions

Gene/Protein Information For MRPS18B (Source: Uniprot.org, NCBI)

Gene Name

MRPS18B

Full Name

28S ribosomal protein S18b, mitochondrial

Weight

29.2 kDa

Superfamily

bacterial ribosomal protein bS18 family

Alternative Names

28S ribosomal protein S18-2, mitochondrial; C6orf1428S ribosomal protein S18b, mitochondrial; HSPC183; HumanS18a; mitochondrial ribosomal protein S18-2; mitochondrial ribosomal protein S18B; MRP-S18-2; MRPS18-2DKFZp564H0223; MRP-S18-b; mrps18-b; PTD017; S18amt; S18mt-b MRPS18B C6orf14, HSPC183, HumanS18a, MRP-S18-2, MRPS18-2, PTD017, S18amt mitochondrial ribosomal protein S18B 28S ribosomal protein S18b, mitochondrial|28S ribosomal protein S18-2, mitochondrial|MRP-S18-b|S18mt-b|mitochondrial ribosomal protein S18-2|mitochondrial small ribosomal subunit protein bS18b|mitochondrial small ribosomal subunit protein bS18m-B|mitochondrial small ribosomal subunit protein mS40|mrps18-b

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MRPS18B, check out the MRPS18B Infographic

MRPS18B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MRPS18B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y676

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MRPS18B (NM_014046) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MRPS18B (NM_014046) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MRPS18B (NM_014046) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y676
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.