MPST (NM_001013436) Human Recombinant Protein

MPST protein,

Product Info Summary

SKU: PROTP25325
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MPST (NM_001013436) Human Recombinant Protein

View all MPST recombinant proteins

SKU/Catalog Number

PROTP25325

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mercaptopyruvate sulfurtransferase (MPST), nuclear gene encoding mitochondrial protein, transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MPST (NM_001013436) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP25325)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33 kDa

Amino Acid Sequence

MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH

Validation Images & Assay Conditions

Gene/Protein Information For MPST (Source: Uniprot.org, NCBI)

Gene Name

MPST

Full Name

3-mercaptopyruvate sulfurtransferase

Weight

33 kDa

Alternative Names

mercaptopyruvate sulfurtransferase; MGC24539; MSThuman liver rhodanese; TST2EC 2.8.1.2,3-mercaptopyruvate sulfurtransferase MPST MST, TST2, TUM1 mercaptopyruvate sulfurtransferase 3-mercaptopyruvate sulfurtransferase|human liver rhodanese|tRNA thiouridin modification protein 1|testicular tissue protein Li 200

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MPST, check out the MPST Infographic

MPST infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MPST: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP25325

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MPST (NM_001013436) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MPST (NM_001013436) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MPST (NM_001013436) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP25325
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.