Product Info Summary
SKU: | PROTP70380-4 |
---|---|
Size: | 5ug,20ug,100ug,500ug,1mg |
Origin Species: | Mouse |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant IL-18 (Interleukin-18) protein, AF
View all IL-18/IL-1F4 recombinant proteins
SKU/Catalog Number
PROTP70380-4
Size
5ug,20ug,100ug,500ug,1mg
Tag
His Tag (C-term)
Description
Interleukin-18 (IL-18) belongs to the IL-1 superfamily and is constitutively produced by macrophages, dendritic cells (DCs) and other cells. IL-18 binds to the receptor of IL-18 (IL-18R) and initiate the recruitment and heterodimerization of the IL-18RAcP, leading to downstream activation of NF-κB. After stimulation with IL-18, multiple cytokines including IFN-γ, IL-13, IL-4, IL-8, and GM-CSF and both Th1 and Th2 lymphokines could be produced by different cells. As an immunoregulaory cytokine, IL-18 can promote development of T helper 1 (Th1) cells, which maximizes the production of IFN by synergistically stimulating to mature Th1 effectors in combination with IL-12. On the contrary, it inhibits the production of the anti-inflammatory cytokine IL-10. In addition, IL-18 exhibits multiple proinflammatory functions, such as increases in cell adhesion molecules, nitric oxide synthesis, and chemokine production.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant IL-18 (Interleukin-18) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP70380-4)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
22.326kDa
Molecular weight
The protein has a calculated MW of 19.1 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce IFN gamma secretion in KG-1 cells. The ED₅₀ for this effect is <0.5 μg/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse IL-18
Protein Target Info & Infographic
Gene/Protein Information For IL18 (Source: Uniprot.org, NCBI)
Gene Name
IL18
Full Name
Interleukin-18
Weight
22.326kDa
Superfamily
IL-1 family
Alternative Names
IGIF IL18 IGIF, IL-18, IL-1g, IL1F4 interleukin 18 interleukin-18|IFN-gamma-inducing factor|IL-1 gamma|iboctadekin|interleukin 18 (interferon-gamma-inducing factor)|interleukin-1 gamma
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL18, check out the IL18 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL18: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant IL-18 (Interleukin-18) protein, AF (PROTP70380-4)
Hello CJ!
No publications found for PROTP70380-4
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant IL-18 (Interleukin-18) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant IL-18 (Interleukin-18) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question