Mouse recombinant IL-18 (Interleukin-18) protein, AF

IL-18/IL-1F4 protein, Mouse

Interleukin-18 (IL-18) belongs to the IL-1 superfamily and is constitutively produced by macrophages, dendritic cells (DCs) and other cells. IL-18 binds to the receptor of IL-18 (IL-18R) and initiate the recruitment and heterodimerization of the IL-18RAcP, leading to downstream activation of NF-κB. After stimulation with IL-18, multiple cytokines including IFN-γ, IL-13, IL-4, IL-8, and GM-CSF and both Th1 and Th2 lymphokines could be produced by different cells. As an immunoregulaory cytokine, IL-18 can promote development of T helper 1 (Th1) cells, which maximizes the production of IFN by synergistically stimulating to mature Th1 effectors in combination with IL-12. On the contrary, it inhibits the production of the anti-inflammatory cytokine IL-10. In addition, IL-18 exhibits multiple proinflammatory functions, such as increases in cell adhesion molecules, nitric oxide synthesis, and chemokine production.

Product Info Summary

SKU: PROTP70380-4
Size: 5ug,20ug,100ug,500ug,1mg
Origin Species: Mouse
Source: Escherichia coli
Application: Cell Culture

Product Name

Mouse recombinant IL-18 (Interleukin-18) protein, AF

View all IL-18/IL-1F4 recombinant proteins

SKU/Catalog Number

PROTP70380-4

Size

5ug,20ug,100ug,500ug,1mg

Tag

His Tag (C-term)

Description

Interleukin-18 (IL-18) belongs to the IL-1 superfamily and is constitutively produced by macrophages, dendritic cells (DCs) and other cells. IL-18 binds to the receptor of IL-18 (IL-18R) and initiate the recruitment and heterodimerization of the IL-18RAcP, leading to downstream activation of NF-κB. After stimulation with IL-18, multiple cytokines including IFN-γ, IL-13, IL-4, IL-8, and GM-CSF and both Th1 and Th2 lymphokines could be produced by different cells. As an immunoregulaory cytokine, IL-18 can promote development of T helper 1 (Th1) cells, which maximizes the production of IFN by synergistically stimulating to mature Th1 effectors in combination with IL-12. On the contrary, it inhibits the production of the anti-inflammatory cytokine IL-10. In addition, IL-18 exhibits multiple proinflammatory functions, such as increases in cell adhesion molecules, nitric oxide synthesis, and chemokine production.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Mouse recombinant IL-18 (Interleukin-18) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP70380-4)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

22.326kDa

Molecular weight

The protein has a calculated MW of 19.1 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce IFN gamma secretion in KG-1 cells. The ED₅₀ for this effect is <0.5 μg/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For IL18 (Source: Uniprot.org, NCBI)

Gene Name

IL18

Full Name

Interleukin-18

Weight

22.326kDa

Superfamily

IL-1 family

Alternative Names

IGIF IL18 IGIF, IL-18, IL-1g, IL1F4 interleukin 18 interleukin-18|IFN-gamma-inducing factor|IL-1 gamma|iboctadekin|interleukin 18 (interferon-gamma-inducing factor)|interleukin-1 gamma

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IL18, check out the IL18 Infographic

IL18 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL18: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP70380-4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Mouse recombinant IL-18 (Interleukin-18) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse recombinant IL-18 (Interleukin-18) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse recombinant IL-18 (Interleukin-18) protein, AF

Size

Total: $77

SKU:PROTP70380-4

Backordered.

Lead time for this item is typically 2-4 weeks

Get A Quote
In stock
Order Product
PROTP70380-4
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.