Product Info Summary
SKU: | PROTQ62386-4 |
---|---|
Size: | 5ug,20ug,100ug |
Origin Species: | Mouse |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant IL-17A (Interleukin-17A) protein, AF
View all IL-17/IL-17A recombinant proteins
SKU/Catalog Number
PROTQ62386-4
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Interleukin 17A (IL-17A) predicts a molecular mass of 35 kDa, encoded IL17A gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappa B and mitogen-activated protein kinases.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant IL-17A (Interleukin-17A) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ62386-4)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
17.504kDa
Molecular weight
The protein has a calculated MW of 15.92 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant mouse IL-17A is > 1 x 10⁶ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse IL-17A
Protein Target Info & Infographic
Gene/Protein Information For IL17A (Source: Uniprot.org, NCBI)
Gene Name
IL17A
Full Name
Interleukin-17A
Weight
17.504kDa
Superfamily
IL-17 family
Alternative Names
CTLA-8 IL17A CTLA-8, CTLA8, IL-17, IL-17A, IL17 interleukin 17A interleukin-17A|cytotoxic T-lymphocyte-associated 8|cytotoxic T-lymphocyte-associated protein 8|interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8)
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL17A, check out the IL17A Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL17A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant IL-17A (Interleukin-17A) protein, AF (PROTQ62386-4)
Hello CJ!
No publications found for PROTQ62386-4
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant IL-17A (Interleukin-17A) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant IL-17A (Interleukin-17A) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question