Click image to see more details
Product Info Summary
| SKU: | PROTP01582-6 |
|---|---|
| Size: | 5ug,20ug,100ug,500ug,1mg |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant IL-1 alpha (Interleukin-1 alpha) protein, AF
View all IL-1 alpha/IL-1F1 recombinant proteins
SKU/Catalog Number
PROTP01582-6
Size
5ug,20ug,100ug,500ug,1mg
Tag
His Tag (C-term)
Description
Interleukin-1 alpha (IL1 alpha or IL1α) is a member of the interleukin-1 cytokine family, found constitutively present in epithelial layers of the entire gastrointestinal tract, lung, liver, kidney, endothelial cells, and astrocytes. The synthesized IL-1 alpha is a 31 kDa inactive precursor and can be cleaved by intracellular caspase-1 or extracellular proteases to generate the bioactive 17 kDa form and the 16 kDa N-terminal cleavage product. Both precursor and mature IL-1 alpha protein bind to the IL-1 receptor (IL-1R), initiating a cascade of inflammatory cytokines and chemokines production such as IL-6, IL-8, and TNF, in response to viral and bacterial pathogens conditions. IL-1 alpha plays a central role in immune-surveillance mechanisms, stimulating macrophages, neutrophils, and CD8+ T cells activity.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant IL-1 alpha (Interleukin-1 alpha) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01582-6)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
30.607kDa
Molecular weight
The protein has a calculated MW of 18.93 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce D10.G4.1 cells proliferation. The ED₅₀ for this effect is <5 pg/mL. The specific activity of recombinant mouse IL-1 alpha is > 2 x 10⁸ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse IL-1 alpha
Protein Target Info & Infographic
Gene/Protein Information For IL1A (Source: Uniprot.org, NCBI)
Gene Name
IL1A
Full Name
Interleukin-1 alpha
Weight
30.607kDa
Superfamily
IL-1 family
Alternative Names
Hematopoietin-1, Lymphocyte-Activating Factor (LAF), Endogenous Pyrogen (EP), Leukocyte IL1A IL-1 alpha, IL-1A, IL1, IL1-ALPHA, IL1F1 interleukin 1 alpha interleukin-1 alpha|hematopoietin-1|preinterleukin 1 alpha|pro-interleukin-1-alpha
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL1A, check out the IL1A Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL1A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant IL-1 alpha (Interleukin-1 alpha) protein, AF (PROTP01582-6)
Hello CJ!
No publications found for PROTP01582-6
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant IL-1 alpha (Interleukin-1 alpha) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant IL-1 alpha (Interleukin-1 alpha) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
