Mouse recombinant CXCL7 (48-109) (C-X-C motif chemokine 7) protein, AF

PPBP protein, Mouse

C-X-C motif chemokine 7 (CXCL7) also named Pro-Platelet basic protein (PPBP), which is a chemokine of the intercrine alpha family. CXCL7 is a 8.2 kDa protein containing 74 amino acid residues. CXCL7 is expressed by the platelets, which are activated. During vascular injury, CXCL7 controls the glucose metabolism, mitogenesis and neutrophil recruitment by the interaction with CXCR2.

Product Info Summary

SKU: PROTQ9EQI5-1
Size: 5ug,20ug,100ug
Origin Species: Mouse
Source: Escherichia coli
Application: Cell Culture

Product Name

Mouse recombinant CXCL7 (48-109) (C-X-C motif chemokine 7) protein, AF

View all PPBP recombinant proteins

SKU/Catalog Number

PROTQ9EQI5-1

Size

5ug,20ug,100ug

Tag

His Tag (N-term)

Description

C-X-C motif chemokine 7 (CXCL7) also named Pro-Platelet basic protein (PPBP), which is a chemokine of the intercrine alpha family. CXCL7 is a 8.2 kDa protein containing 74 amino acid residues. CXCL7 is expressed by the platelets, which are activated. During vascular injury, CXCL7 controls the glucose metabolism, mitogenesis and neutrophil recruitment by the interaction with CXCR2.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Mouse recombinant CXCL7 (48-109) (C-X-C motif chemokine 7) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9EQI5-1)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

13.894kDa

Molecular weight

The protein has a calculated MW of 7.57 kDa. The protein migrates below 11 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <5 ng/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

IELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKI with polyhistidine tag at the N-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For Ppbp (Source: Uniprot.org, NCBI)

Gene Name

Ppbp

Full Name

Platelet basic protein

Weight

13.894kDa

Superfamily

intercrine alpha (chemokine CxC) family

Alternative Names

NAP-2, PPBP, CT, CTA, CTAP3, CTAPIII,LA-PF4, LDG, LDGF, MDGF, NAP-2-L1, Scyb, Scyb7, TGB, TGB1, THBGB1, b-TG1, beta-T, beta-TG PPBP B-TG1, Beta-TG, CTAP-III, CTAP3, CTAPIII, CXCL7, LA-PF4, LDGF, MDGF, NAP-2, PBP, SCYB7, TC1, TC2, TGB, TGB1, THBGB, THBGB1 pro-platelet basic protein platelet basic protein|C-X-C motif chemokine 7|CXC chemokine ligand 7|beta-thromboglobulin|chemokine (C-X-C motif) ligand 7|connective tissue-activating peptide III|leukocyte-derived growth factor|low-affinity platelet factor IV|macrophage-derived growth factor|neutrophil-activating peptide 2|small inducible cytokine B7|small inducible cytokine subfamily B, member 7|thrombocidin 1|thrombocidin 2|thromboglobulin, beta-1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Ppbp, check out the Ppbp Infographic

Ppbp infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Ppbp: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9EQI5-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Mouse recombinant CXCL7 (48-109) (C-X-C motif chemokine 7) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse recombinant CXCL7 (48-109) (C-X-C motif chemokine 7) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse recombinant CXCL7 (48-109) (C-X-C motif chemokine 7) protein, AF

Size

Total: $77

SKU:PROTQ9EQI5-1

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTQ9EQI5-1
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.