Product Info Summary
SKU: | PROTQ9EQI5 |
---|---|
Size: | 5ug,20ug,100ug |
Origin Species: | Mouse |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant CXCL7 (40-113) (C-X-C motif chemokine 7) protein, AF
View all PPBP recombinant proteins
SKU/Catalog Number
PROTQ9EQI5
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
C-X-C motif chemokine 7 (CXCL7) also named Pro-Platelet basic protein (PPBP), which is a chemokine of the intercrine alpha family. CXCL7 is a 8.2 kDa protein containing 74 amino acid residues. CXCL7 is expressed by the platelets, which are activated. During vascular injury, CXCL7 controls the glucose metabolism, mitogenesis and neutrophil recruitment by the interaction with CXCR2.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant CXCL7 (40-113) (C-X-C motif chemokine 7) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9EQI5)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
13.894kDa
Molecular weight
The protein has a calculated MW of 8.93 kDa. The protein migrates below 11 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <1 μg/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
KSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKILEGY with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse CXCL7 (40-113)
Protein Target Info & Infographic
Gene/Protein Information For Ppbp (Source: Uniprot.org, NCBI)
Gene Name
Ppbp
Full Name
Platelet basic protein
Weight
13.894kDa
Superfamily
intercrine alpha (chemokine CxC) family
Alternative Names
2400003M24Rik, AI854500, CT, CTA, CTAP3, CTAPIII,LA-PF4, LDG, LDGF, MDGF, NAP-2-L1, Scyb, Scyb7, TGB, TGB1, THBGB1, b-TG1, beta-T, beta-TG PPBP B-TG1, Beta-TG, CTAP-III, CTAP3, CTAPIII, CXCL7, LA-PF4, LDGF, MDGF, NAP-2, PBP, SCYB7, TC1, TC2, TGB, TGB1, THBGB, THBGB1 pro-platelet basic protein platelet basic protein|C-X-C motif chemokine 7|CXC chemokine ligand 7|beta-thromboglobulin|chemokine (C-X-C motif) ligand 7|connective tissue-activating peptide III|leukocyte-derived growth factor|low-affinity platelet factor IV|macrophage-derived growth factor|neutrophil-activating peptide 2|small inducible cytokine B7|small inducible cytokine subfamily B, member 7|thrombocidin 1|thrombocidin 2|thromboglobulin, beta-1
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on Ppbp, check out the Ppbp Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Ppbp: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant CXCL7 (40-113) (C-X-C motif chemokine 7) protein, AF (PROTQ9EQI5)
Hello CJ!
No publications found for PROTQ9EQI5
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant CXCL7 (40-113) (C-X-C motif chemokine 7) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant CXCL7 (40-113) (C-X-C motif chemokine 7) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question