Click image to see more details
Product Info Summary
| SKU: | PROTQ16653 |
|---|---|
| Size: | 10ug, 50ug, 1mg |
| Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
MOG Myelin Oligodendrocyte Glycoprotein Human Recombinant Protein
View all MOG recombinant proteins
SKU/Catalog Number
PROTQ16653
Size
10ug, 50ug, 1mg
Description
Myelin Oligodendrocyte Glycoprotein produced in E. coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa.
Storage & Handling
Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Cite This Product
MOG Myelin Oligodendrocyte Glycoprotein Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16653)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The Myelin Oligodendrocyte Glycoprotein was lyophilized from a 0.2µm filtered solution in 20mM HAc-NaAc and 150mM NaCl pH-4.5
Purity
Greater than 95.0% as determined by SDS-PAGE.
Reconstitution
It is recommended to reconstitute the lyophilized MOG in sterile 50mM Acetic acid not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRN GKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQE EAAMELKVEDPFYWVSPGHHHHHH
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized MOG in sterile 50mM Acetic acid not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For MOG (Source: Uniprot.org, NCBI)
Gene Name
MOG
Full Name
Myelin-oligodendrocyte glycoprotein
Weight
Superfamily
immunoglobulin superfamily
Alternative Names
MGC26137; MOG Ig-AluB; MOG; MOGIG2; myelin oligodendrocyte glycoprotein; myelin-oligodendrocyte glycoprotein MOG BTN6, BTNL11IG2, NRCLP7, MOG myelin oligodendrocyte glycoprotein myelin-oligodendrocyte glycoprotein|MOG AluA|MOG AluB|MOG Ig-AluB|MOG alpha-5
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on MOG, check out the MOG Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for MOG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For MOG Myelin Oligodendrocyte Glycoprotein Human Recombinant Protein (PROTQ16653)
Hello CJ!
No publications found for PROTQ16653
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used MOG Myelin Oligodendrocyte Glycoprotein Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For MOG Myelin Oligodendrocyte Glycoprotein Human Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
