Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband®

MOG antibody

Boster Bio Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband® catalog # A03294. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: A03294
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband®

View all MOG Antibodies

SKU/Catalog Number

A03294

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband® catalog # A03294. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03294)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human Myelin oligodendrocyte glycoprotein/MOG, which shares 85.7% and 88.6% amino acid (aa) sequence identity with mouse and rat Myelin oligodendrocyte glycoprotein/MOG, respectively.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A03294 is reactive to MOG in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

26 kDa

Calculated molecular weight

28.193kDa

Background of MOG

Myelin oligodendrocyte glycoprotein (MOG) is a glycoprotein believed to be important in the myelination of nerves in the central nervous system (CNS). In humans this protein is encoded by the MOG gene. This gene is mapped to 6p22.1. It is speculated to serve as a necessary "adhesion molecule" to provide structural integrity to the myelin sheath and is known to develop late on the oligodendrocyte. The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A03294 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Positive Control

WB: rat brain tissue, mouse brain tissue,
IHC: human glioma tissue, mouse brain tissue, rat brain tissue, rat brain tissue
FCM: U251 cell

Validation Images & Assay Conditions

Gene/Protein Information For MOG (Source: Uniprot.org, NCBI)

Gene Name

MOG

Full Name

Myelin-oligodendrocyte glycoprotein

Weight

28.193kDa

Superfamily

immunoglobulin superfamily

Alternative Names

Myelin-oligodendrocyte glycoprotein; MOG MOG BTN6, BTNL11IG2, NRCLP7, MOG myelin oligodendrocyte glycoprotein myelin-oligodendrocyte glycoprotein|MOG AluA|MOG AluB|MOG Ig-AluB|MOG alpha-5

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on MOG, check out the MOG Infographic

MOG infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MOG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A03294

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

18 Customer Q&As for Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband®

Question

Can you verify if A03294 works in ICC?

Verified customer

Asked: 2020-11-06

Answer

The Anti-Myelin Oligodendrocyte Glycoprotein/MOG Antibody Picoband™ (A03294) has been validated for Flow Cytometry, IHC-P, WB. It has not been validated for ICC, so there's no guarantee that it would work.

Boster Scientific Support

Answered: 2020-11-06

Question

I was wanting to use your anti-Myelin oligodendrocyte glycoprotein/MOG antibody for IHC-P for rat brain cortex on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat brain cortex identification?

Verified Customer

Verified customer

Asked: 2020-04-20

Answer

It shows on the product datasheet, A03294 anti-Myelin oligodendrocyte glycoprotein/MOG antibody has been validated for Flow Cytometry, IHC-P, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat brain cortex in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-04-20

Question

We are currently using anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2020-02-27

Answer

The anti-Myelin oligodendrocyte glycoprotein/MOG antibody (A03294) has not been tested for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-02-27

Question

My lab would like using your anti-Myelin oligodendrocyte glycoprotein/MOG antibody for narcolepsy 7 (nrclp7) studies. Has this antibody been tested with western blotting on rat brain tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2020-02-18

Answer

We appreciate your inquiry. This A03294 anti-Myelin oligodendrocyte glycoprotein/MOG antibody is tested on rat brain tissue, mouse brain, u251 cells. It is guaranteed to work for Flow Cytometry, IHC-P, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2020-02-18

Question

My question regarding product A03294, anti-Myelin oligodendrocyte glycoprotein/MOG antibody . I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-12-25

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A03294 anti-Myelin oligodendrocyte glycoprotein/MOG antibody , we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-12-25

Question

We are currently using anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2019-09-20

Answer

The anti-Myelin oligodendrocyte glycoprotein/MOG antibody (A03294) has not been tested for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-09-20

Question

See below the WB image, lot number and protocol we used for brain cortex using anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-08-22

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-08-22

Question

We ordered your anti-Myelin oligodendrocyte glycoprotein/MOG antibody for Flow Cytometry on brain cortex a few months ago. I am using human, and We are going to use the antibody for IHC-P next. My question regards examining brain cortex as well as c1 segment of cervical spinal cord in our next experiment. Could give a recommendation on which antibody would work the best for IHC-P?

Verified Customer

Verified customer

Asked: 2019-06-24

Answer

I looked at the website and datasheets of our anti-Myelin oligodendrocyte glycoprotein/MOG antibody and it seems that A03294 has been tested on human in both Flow Cytometry and IHC-P. Thus A03294 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC-P in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC-P detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-06-24

Question

We have been able to see staining in mouse brain. What should we do? Is anti-Myelin oligodendrocyte glycoprotein/MOG antibody supposed to stain brain positively?

Verified Customer

Verified customer

Asked: 2018-08-08

Answer

Based on literature brain does express MOG. Based on Uniprot.org, MOG is expressed in c1 segment of cervical spinal cord, brain, brain cortex, among other tissues. Regarding which tissues have MOG expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 7964757, 15489334
Brain cortex, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2018-08-08

Question

Is a blocking peptide available for product anti-Myelin oligodendrocyte glycoprotein/MOG antibody (A03294)?

Verified Customer

Verified customer

Asked: 2018-05-30

Answer

We do provide the blocking peptide for product anti-Myelin oligodendrocyte glycoprotein/MOG antibody (A03294). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-05-30

Question

Is there a BSA free version of anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 available?

Verified Customer

Verified customer

Asked: 2018-03-27

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-03-27

Question

Is this A03294 anti-Myelin oligodendrocyte glycoprotein/MOG antibody reactive to the isotypes of MOG?

Verified Customer

Verified customer

Asked: 2018-01-24

Answer

The immunogen of A03294 anti-Myelin oligodendrocyte glycoprotein/MOG antibody is A synthetic peptide corresponding to a sequence of human Myelin oligodendrocyte glycoprotein/MOG (RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-01-24

Question

We need to test anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 on rat brain cortex for research purposes, then I may be interested in using anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2017-12-18

Answer

The products we sell, including anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2017-12-18

Question

My boss were satisfied with the WB result of your anti-Myelin oligodendrocyte glycoprotein/MOG antibody . However we have observed positive staining in brain cortex isoform 1: cell membrane using this antibody. Is that expected? Could you tell me where is MOG supposed to be expressed?

Verified Customer

Verified customer

Asked: 2017-08-02

Answer

From what I have seen in literature, brain cortex does express MOG. Generally MOG expresses in isoform 1: cell membrane. Regarding which tissues have MOG expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 7964757, 15489334
Brain cortex, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2017-08-02

Question

Will anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 work for IHC-P with brain cortex?

S. Thomas

Verified customer

Asked: 2017-05-31

Answer

According to the expression profile of brain cortex, MOG is highly expressed in brain cortex. So, it is likely that anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 will work for IHC-P with brain cortex.

Boster Scientific Support

Answered: 2017-05-31

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain cortex using anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294. Let me know if you need anything else.

S. Wu

Verified customer

Asked: 2015-09-21

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2015-09-21

Question

Will A03294 anti-Myelin oligodendrocyte glycoprotein/MOG antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

K. Kulkarni

Verified customer

Asked: 2014-11-14

Answer

You can see on the product datasheet, A03294 anti-Myelin oligodendrocyte glycoprotein/MOG antibody as been tested on IHC-P. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2014-11-14

Question

I see that the anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 works with IHC-P, what is the protocol used to produce the result images on the product page?

Z. Jha

Verified customer

Asked: 2013-01-24

Answer

You can find protocols for IHC-P on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2013-01-24

Order DetailsPrice
A03294

100μg

$370
A03294-10ug

10μg sample (liquid)

$99
A03294-Biotin

100 μg Biotin conjugated

$570
A03294-Cy3

100 μg Cy3 conjugated

$570
A03294-Dylight488

100 μg Dylight488 conjugated

$570
A03294-Dylight550

100 μg Dylight550 conjugated

$570
A03294-Dylight594

100 μg Dylight594 conjugated

$570
A03294-FITC

100 μg FITC conjugated

$570
A03294-HRP

100 μg HRP conjugated

$570
A03294-APC

100 μg APC conjugated

$670
A03294-PE

100 μg PE conjugated

$670
A03294-iFluor647

100 μg iFluor647 conjugated

$670
A03294-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A03294
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.