MICA (NM_001177519) Human Recombinant Protein

MICA protein,

Purified recombinant protein of Homo sapiens MHC class I polypeptide-related sequence A (MICA), transcript variant 1 (allele MICA*00801).

Product Info Summary

SKU: PROTQ29983
Size: 20 µg
Source: HEK293T

Product Name

MICA (NM_001177519) Human Recombinant Protein

View all MICA recombinant proteins

SKU/Catalog Number

PROTQ29983

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens MHC class I polypeptide-related sequence A (MICA), transcript variant 1 (allele MICA*00801).

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MICA (NM_001177519) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ29983)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

0.0383kDa

Amino Acid Sequence

MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAGCCYFCYYYFLCPLL

Validation Images & Assay Conditions

Gene/Protein Information For MICA (Source: Uniprot.org, NCBI)

Gene Name

MICA

Full Name

MHC class I polypeptide-related sequence A

Weight

0.0383kDa

Superfamily

MHC class I family

Alternative Names

FLJ60820; MGC111087; MICA; PERB11.1 MICA MIC-A, PERB11.1 MHC class I polypeptide-related sequence A MHC class I polypeptide-related sequence A|HLA class I antigen|MHC class I chain-related protein A|MHC class I related chain A|MHC class I related sequence A|major histocompatibility complex class I chain-related protein A|stress inducible class I homolog|truncated MHC class I polypeptide-related sequence A|truncated MICA

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MICA, check out the MICA Infographic

MICA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MICA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ29983

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MICA (NM_001177519) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MICA (NM_001177519) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MICA (NM_001177519) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ29983
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.