MC2 receptor (MC2R) (NM_000529) Human Recombinant Protein

Melanocortin-2 R/MC2R protein,

Recombinant protein of human melanocortin 2 receptor (adrenocorticotropic hormone) (MC2R)

Product Info Summary

SKU: PROTQ01718
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MC2 receptor (MC2R) (NM_000529) Human Recombinant Protein

View all Melanocortin-2 R/MC2R recombinant proteins

SKU/Catalog Number

PROTQ01718

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human melanocortin 2 receptor (adrenocorticotropic hormone) (MC2R)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MC2 receptor (MC2R) (NM_000529) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ01718)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.7 kDa

Amino Acid Sequence

MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW

Validation Images & Assay Conditions

Gene/Protein Information For MC2R (Source: Uniprot.org, NCBI)

Gene Name

MC2R

Full Name

Adrenocorticotropic hormone receptor

Weight

33.7 kDa

Superfamily

G-protein coupled receptor 1 family

Alternative Names

ACTH receptor; ACTHR; ACTH-R; ACTHRcorticotropin receptor; adrenocorticotropic hormone receptor; Adrenocorticotropin receptor; MC2 receptor; MC2R; MC2-R; melanocortin 2 receptor (adrenocorticotropic hormone); Melanocortin receptor 2; Melanocortin-2 R; Melanocortin2R; Melanocortin-2R; MGC125798 MC2R ACTHR melanocortin 2 receptor adrenocorticotropic hormone receptor|ACTH receptor|MC2 receptor|adrenocorticotropin receptor|corticotropin receptor|melanocortin 2 receptor (adrenocorticotropic hormone)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MC2R, check out the MC2R Infographic

MC2R infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MC2R: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ01718

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MC2 receptor (MC2R) (NM_000529) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MC2 receptor (MC2R) (NM_000529) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MC2 receptor (MC2R) (NM_000529) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ01718
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.