Mannan Binding Lectin (MBL2) (NM_000242) Human Recombinant Protein

MBL2 protein,

Product Info Summary

SKU: PROTP11226
Size: 20 µg
Source: HEK293T

Product Name

Mannan Binding Lectin (MBL2) (NM_000242) Human Recombinant Protein

View all MBL2 recombinant proteins

SKU/Catalog Number

PROTP11226

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mannose-binding lectin (protein C) 2, soluble (opsonic defect) (MBL2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Mannan Binding Lectin (MBL2) (NM_000242) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP11226)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24 kDa

Amino Acid Sequence

MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

Validation Images & Assay Conditions

Gene/Protein Information For MBL2 (Source: Uniprot.org, NCBI)

Gene Name

MBL2

Full Name

Mannose-binding protein C

Weight

24 kDa

Alternative Names

COLEC1; COLEC1collectin-1; Collectin-1; HSMBPC; Mannan-binding protein; mannose-binding lectin (protein C) 2, soluble (opsonic defect); mannose-binding lectin (protein C) 2, soluble; Mannose-binding lectin; mannose-binding protein C; MBL; MBL2; MBL2D; MBLmannan-binding lectin; MBP; MBP1; MBP1mannose-binding lectin 2, soluble (opsonic defect); MBP-C; MGC116832; MGC116833 MBL2 COLEC1, HSMBPC, MBLD, MBP, MBP-C, MBP1, MBPD, MBL2 mannose binding lectin 2 mannose-binding protein C|collectin-1|mannan-binding lectin|mannose-binding lectin (protein C) 2, soluble (opsonic defect)|mannose-binding lectin 2, soluble (opsonic defect)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MBL2, check out the MBL2 Infographic

MBL2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MBL2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP11226

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Mannan Binding Lectin (MBL2) (NM_000242) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mannan Binding Lectin (MBL2) (NM_000242) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mannan Binding Lectin (MBL2) (NM_000242) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP11226
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.