MAN1 (LEMD3) (NM_001167614) Human Recombinant Protein

LEMD3 protein,

Recombinant protein of human LEM domain containing 3 (LEMD3), transcript variant 2.

Product Info Summary

SKU: PROTQ9Y2U8
Size: 20 µg
Source: HEK293T

Product Name

MAN1 (LEMD3) (NM_001167614) Human Recombinant Protein

View all LEMD3 recombinant proteins

SKU/Catalog Number

PROTQ9Y2U8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human LEM domain containing 3 (LEMD3), transcript variant 2.

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MAN1 (LEMD3) (NM_001167614) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y2U8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

0.1003kDa

Amino Acid Sequence

MAAAAASAPQQLSDEELFSQLRRYGLSPGPVTESTRPVYLKKLKKLREEEQQQHRSGGRGNKTRNSNNNNTAAATVAAAGPAAAAAAGMGVRPVSGDLSYLRTPGGLCRISASGPESLLGGPGGASAAPAAGSKVLLGFSSDESDVEASPRDQAGGGGRKDRASLQYRGLKAPPAPLAASEVTNSNSAERRKPHSWWGARRPAGPELQTPPGKDGAVEDEEGEGEDGEERDPETEEPLWASRTVNGSRLVPYSCRENYSDSEEEDDDDVASSRQVLKDDSLSRHRPRRTHSKPLPPLTAKSAGGRLETSVQGGGGLAMNDRAAAAGSLDRSRNLEEAAAAEQGGGCDQVDSSPVPRYRVNAKKLTPLLPPPLTDMDSTLDSSTGSLLKTNNHIGGGAFSVDSPRIYSNSLPPSAAVAASSSLRINHANHTGSNHTYLKNTYNKPKLSEPEEELLQQFKREEVSPTGSFSAHYLSMFLLTAACLFFLILGLTYLGMRGTGVSEDGELSKNPFGETFGKIQESEKTLMMNTLYKLHDRLAQLAGDHECGSSSQRTLSVQEAAAYLKDLGPEYEGIFNTSLQWILENGKDVGIRCVGFGPEEELTNITDVQFLQSTRPLMSFWCRFRRAFVTVTHRLLLLCLGVVMVCVVLRYMKYRWTKEEEETRQMYDMVVKIIDVLRSHNEACQENKDLQPYMPIPHVRDSLIQPHDRKKMKKVWDRAVDFLAANESRVRTETRRIGGADFLVWRWIQPSASCDKILVIPSKVWQGQAFHLDRRNSPPNSLTPCLKIRNMFDPVMEIGDQWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLSPEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQALTSNTPLKPSNKHMNSMSHLRLRTGLTNSQGSS

Validation Images & Assay Conditions

Gene/Protein Information For LEMD3 (Source: Uniprot.org, NCBI)

Gene Name

LEMD3

Full Name

Inner nuclear membrane protein Man1

Weight

0.1003kDa

Alternative Names

inner nuclear membrane protein Man1; integral inner nuclear membrane protein; LEM domain containing 3; MAN1LEM domain-containing protein 3 LEMD3 MAN1 LEM domain containing 3 inner nuclear membrane protein Man1|LEM domain-containing protein 3|LEMD3/MKX fusion|MAN 1|integral inner nuclear membrane protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LEMD3, check out the LEMD3 Infographic

LEMD3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LEMD3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y2U8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MAN1 (LEMD3) (NM_001167614) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MAN1 (LEMD3) (NM_001167614) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MAN1 (LEMD3) (NM_001167614) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y2U8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.