MAD2 (MAD2L1) (NM_002358) Human Recombinant Protein

MAD2L1 protein,

Product Info Summary

SKU: PROTQ13257
Size: 20 µg
Source: HEK293T

Product Name

MAD2 (MAD2L1) (NM_002358) Human Recombinant Protein

View all MAD2L1 recombinant proteins

SKU/Catalog Number

PROTQ13257

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human MAD2 mitotic arrest deficient-like 1 (yeast) (MAD2L1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MAD2 (MAD2L1) (NM_002358) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13257)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.3 kDa

Amino Acid Sequence

MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND

Validation Images & Assay Conditions

Gene/Protein Information For MAD2L1 (Source: Uniprot.org, NCBI)

Gene Name

MAD2L1

Full Name

Mitotic spindle assembly checkpoint protein MAD2A

Weight

23.3 kDa

Superfamily

MAD2 family

Alternative Names

HSMAD2; MAD2 (mitotic arrest deficient, yeast, homolog)-like 1; MAD2 mitotic arrest deficient-like 1 (yeast); MAD2L1; MAD2-like protein 1; MAD2mitotic arrest deficient, yeast, homolog-like 1; Mitotic arrest deficient 2-like protein 1; mitotic spindle assembly checkpoint protein MAD2A MAD2L1 HSMAD2, MAD2 mitotic arrest deficient 2 like 1 mitotic spindle assembly checkpoint protein MAD2A|MAD2 (mitotic arrest deficient, yeast, homolog)-like 1|MAD2 mitotic arrest deficient-like 1|MAD2-like protein 1|mitotic arrest deficient 2-like protein 1|mitotic arrest deficient, yeast, homolog-like 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MAD2L1, check out the MAD2L1 Infographic

MAD2L1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MAD2L1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13257

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MAD2 (MAD2L1) (NM_002358) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MAD2 (MAD2L1) (NM_002358) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MAD2 (MAD2L1) (NM_002358) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13257
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.