LSM1 (NM_014462) Human Recombinant Protein

LSM1 protein,

Product Info Summary

SKU: PROTO15116
Size: 20 µg
Source: HEK293T

Product Name

LSM1 (NM_014462) Human Recombinant Protein

View all LSM1 recombinant proteins

SKU/Catalog Number

PROTO15116

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LSM1 (NM_014462) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15116)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15 kDa

Amino Acid Sequence

MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY

Validation Images & Assay Conditions

Gene/Protein Information For LSM1 (Source: Uniprot.org, NCBI)

Gene Name

LSM1

Full Name

U6 snRNA-associated Sm-like protein LSm1

Weight

15 kDa

Superfamily

snRNP Sm proteins family

Alternative Names

Cancer-associated Sm-like; CASMYJL124C; LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae); Small nuclear ribonuclear CaSm; U6 snRNA-associated Sm-like protein LSm1 LSM1 CASM, YJL124C LSM1 homolog, mRNA degradation associated U6 snRNA-associated Sm-like protein LSm1|LSM1 homolog, U6 small nuclear RNA associated|LSM1 mRNA degradation associated|LSM1, U6 small nuclear RNA associated|LSM1-like protein U6 small nuclear RNA associated|cancer-associated Sm protein|cancer-associated Sm-like protein|small nuclear ribonuclear CaSm

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LSM1, check out the LSM1 Infographic

LSM1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LSM1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO15116

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LSM1 (NM_014462) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LSM1 (NM_014462) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LSM1 (NM_014462) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO15116
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.