LMO2 (NM_005574) Human Recombinant Protein

LMO2 protein,

Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1

Product Info Summary

SKU: PROTP25791
Size: 20 µg
Source: HEK293T

Product Name

LMO2 (NM_005574) Human Recombinant Protein

View all LMO2 recombinant proteins

SKU/Catalog Number

PROTP25791

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LMO2 (NM_005574) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP25791)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.2 kDa

Amino Acid Sequence

MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI

Validation Images & Assay Conditions

Gene/Protein Information For LMO2 (Source: Uniprot.org, NCBI)

Gene Name

LMO2

Full Name

Rhombotin-2

Weight

18.2 kDa

Alternative Names

Cysteine-rich protein TTG-2; LIM domain only 2 (rhombotin-like 1); LIM domain only protein 2; LMO2; LMO-2; RBTN2; RBTN2rhombotin-2; RBTNL1; RBTNL1rhombotin-like 1; RHOM2; RHOM2T-cell translocation protein 2; T-cell translocation gene 2; TTG2; TTG2rhombotin 2 LMO2 LMO-2, RBTN2, RBTNL1, RHOM2, TTG2 LIM domain only 2 rhombotin-2|LIM domain only protein 2|T-cell translocation gene 2|T-cell translocation protein 2|cysteine-rich protein TTG-2|rhombotin-like 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LMO2, check out the LMO2 Infographic

LMO2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LMO2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP25791

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LMO2 (NM_005574) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LMO2 (NM_005574) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LMO2 (NM_005574) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP25791
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.