Anti-LMO2 Antibody Picoband®

LMO2 antibody

Boster Bio Anti-LMO2 Antibody Picoband® catalog # A03502-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: A03502-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-LMO2 Antibody Picoband®

View all LMO2 Antibodies

SKU/Catalog Number

A03502-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-LMO2 Antibody Picoband® catalog # A03502-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-LMO2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03502-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human LMO2, which shares 97% amino acid (aa) sequence identity with both mouse and rat LMO2.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A03502-1 is reactive to LMO2 in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

23 kDa

Calculated molecular weight

18.358kDa

Background of LMO2

LIM domain only 2 (rhombotin-like 1), also known as LMO2, RBTNL1, RBTN2, RHOM2, LIM Domain Only Protein 2, TTG2, and T-Cell Translocation Protein 2, is a protein which in humans is encoded by the LMO2 gene. LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A03502-1 is guaranteed for WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot,0.1-0.5μg/ml

Positive Control

WB: human placenta tissue, human SMMC-7721 whole cell, human A375 whole cell, human A431 whole cell, rat C6 whole cell, mouse Neuro-2a whole cell

Validation Images & Assay Conditions

Gene/Protein Information For LMO2 (Source: Uniprot.org, NCBI)

Gene Name

LMO2

Full Name

Rhombotin-2

Weight

18.358kDa

Alternative Names

Rhombotin-2; Cysteine-rich protein TTG-2; LIM domain only protein 2; LMO-2; T-cell translocation protein 2; LMO2; RBTN2; RBTNL1; RHOM2; TTG2 LMO2 LMO-2, RBTN2, RBTNL1, RHOM2, TTG2 LIM domain only 2 rhombotin-2|LIM domain only protein 2|T-cell translocation gene 2|T-cell translocation protein 2|cysteine-rich protein TTG-2|rhombotin-like 1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on LMO2, check out the LMO2 Infographic

LMO2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LMO2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A03502-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-LMO2 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-LMO2 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-LMO2 Antibody Picoband®

Question

We were satisfied with the WB result of your anti-LMO2 antibody. However we have been able to see positive staining in kidney nucleus. using this antibody. Is that expected? Could you tell me where is LMO2 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-04-17

Answer

From what I have seen in literature, kidney does express LMO2. Generally LMO2 expresses in nucleus. Regarding which tissues have LMO2 expression, here are a few articles citing expression in various tissues:
Brain, and Colon, Pubmed ID: 15489334
Kidney, Pubmed ID: 1923511, 9129143

Boster Scientific Support

Answered: 2020-04-17

Question

Will anti-LMO2 antibody A03502-1 work for WB with brain colon?

Verified Customer

Verified customer

Asked: 2020-04-13

Answer

According to the expression profile of brain colon, LMO2 is highly expressed in brain colon. So, it is likely that anti-LMO2 antibody A03502-1 will work for WB with brain colon.

Boster Scientific Support

Answered: 2020-04-13

Question

My question regards using your anti-LMO2 antibody for multicellular organism development studies. Has this antibody been tested with western blotting on rat c6 whole cell lysates? We would like to see some validation images before ordering.

N. Miller

Verified customer

Asked: 2020-01-24

Answer

Thank you for your inquiry. This A03502-1 anti-LMO2 antibody is validated on human placenta tissue, a431 whole cell lysates, rat c6 whole cell lysates. It is guaranteed to work for WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2020-01-24

Question

My question regarding product A03502-1, anti-LMO2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-12-11

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A03502-1 anti-LMO2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-12-11

Question

Is this A03502-1 anti-LMO2 antibody reactive to the isotypes of LMO2?

Verified Customer

Verified customer

Asked: 2019-10-28

Answer

The immunogen of A03502-1 anti-LMO2 antibody is A synthetic peptide corresponding to a sequence of human LMO2 (QKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-10-28

Question

I was wanting to use your anti-LMO2 antibody for WB for mouse brain colon on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse brain colon identification?

Verified Customer

Verified customer

Asked: 2019-03-26

Answer

It shows on the product datasheet, A03502-1 anti-LMO2 antibody has been validated for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse brain colon in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-03-26

Question

Is there a BSA free version of anti-LMO2 antibody A03502-1 available?

D. Kulkarni

Verified customer

Asked: 2018-11-16

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-LMO2 antibody A03502-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-11-16

Question

Is a blocking peptide available for product anti-LMO2 antibody (A03502-1)?

Verified Customer

Verified customer

Asked: 2018-05-18

Answer

We do provide the blocking peptide for product anti-LMO2 antibody (A03502-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-05-18

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain colon using anti-LMO2 antibody A03502-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2018-04-02

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-04-02

Question

Does A03502-1 anti-LMO2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2017-11-15

Answer

It shows on the product datasheet, A03502-1 anti-LMO2 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2017-11-15

Question

We are interested in to test anti-LMO2 antibody A03502-1 on mouse brain colon for research purposes, then I may be interested in using anti-LMO2 antibody A03502-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

D. Parker

Verified customer

Asked: 2016-08-19

Answer

The products we sell, including anti-LMO2 antibody A03502-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2016-08-19

Question

I have attached the WB image, lot number and protocol we used for brain colon using anti-LMO2 antibody A03502-1. Please let me know if you require anything else.

L. Mangal

Verified customer

Asked: 2016-06-16

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-06-16

Question

I see that the anti-LMO2 antibody A03502-1 works with WB, what is the protocol used to produce the result images on the product page?

D. Mangal

Verified customer

Asked: 2015-12-30

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2015-12-30

Question

We have been able to see staining in rat brain colon. Are there any suggestions? Is anti-LMO2 antibody supposed to stain brain colon positively?

G. Johnson

Verified customer

Asked: 2014-08-06

Answer

Based on literature brain colon does express LMO2. Based on Uniprot.org, LMO2 is expressed in metanephric glomerulus, kidney, brain colon, among other tissues. Regarding which tissues have LMO2 expression, here are a few articles citing expression in various tissues:
Brain, and Colon, Pubmed ID: 15489334
Kidney, Pubmed ID: 1923511, 9129143

Boster Scientific Support

Answered: 2014-08-06

Question

We are currently using anti-LMO2 antibody A03502-1 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on bovine tissues as well?

B. Wu

Verified customer

Asked: 2013-09-17

Answer

The anti-LMO2 antibody (A03502-1) has not been tested for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2013-09-17

Order DetailsPrice
A03502-1

100μg

$370
A03502-1-10ug

10μg sample (liquid)

$99
A03502-1-Biotin

100 μg Biotin conjugated

$570
A03502-1-Cy3

100 μg Cy3 conjugated

$570
A03502-1-Dylight488

100 μg Dylight488 conjugated

$570
A03502-1-Dylight550

100 μg Dylight550 conjugated

$570
A03502-1-Dylight594

100 μg Dylight594 conjugated

$570
A03502-1-FITC

100 μg FITC conjugated

$570
A03502-1-HRP

100 μg HRP conjugated

$570
A03502-1-APC

100 μg APC conjugated

$670
A03502-1-PE

100 μg PE conjugated

$670
A03502-1-iFluor647

100 μg iFluor647 conjugated

$670
A03502-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A03502-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.