Livin (BIRC7) (NM_022161) Human Recombinant Protein

Livin protein,

Product Info Summary

SKU: PROTQ96CA5
Size: 20 µg
Source: HEK293T

Product Name

Livin (BIRC7) (NM_022161) Human Recombinant Protein

View all Livin recombinant proteins

SKU/Catalog Number

PROTQ96CA5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Livin (BIRC7) (NM_022161) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96CA5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.7 kDa

Amino Acid Sequence

MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS

Validation Images & Assay Conditions

Gene/Protein Information For BIRC7 (Source: Uniprot.org, NCBI)

Gene Name

BIRC7

Full Name

Baculoviral IAP repeat-containing protein 7

Weight

30.7 kDa

Superfamily

IAP family

Alternative Names

baculoviral IAP repeat containing 7; baculoviral IAP repeat-containing 7; BIRC7; KIAP; KIAPRING finger protein 50; Kidney inhibitor of apoptosis protein; livin inhibitor-of-apoptosis; Livin; Melanoma inhibitor of apoptosis protein; ML-IAP; MLIAPlivin inhibitor of apoptosis; ML-IAPmliap; RNF50LIVINbaculoviral IAP repeat-containing protein 7 BIRC7 KIAP, LIVIN, ML-IAP, MLIAP, RNF50 baculoviral IAP repeat containing 7 baculoviral IAP repeat-containing protein 7|RING finger protein 50|RING-type E3 ubiquitin transferase BIRC7|kidney inhibitor of apoptosis protein|livin inhibitor of apoptosis|melanoma inhibitor of apoptosis protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BIRC7, check out the BIRC7 Infographic

BIRC7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BIRC7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96CA5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Livin (BIRC7) (NM_022161) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Livin (BIRC7) (NM_022161) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Livin (BIRC7) (NM_022161) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96CA5
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.