KREMEN2 (NM_024507) Human Recombinant Protein

Kremen-2 protein,

Recombinant protein of human kringle containing transmembrane protein 2 (KREMEN2), transcript variant 2

Product Info Summary

SKU: PROTQ8NCW0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

KREMEN2 (NM_024507) Human Recombinant Protein

View all Kremen-2 recombinant proteins

SKU/Catalog Number

PROTQ8NCW0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human kringle containing transmembrane protein 2 (KREMEN2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

KREMEN2 (NM_024507) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8NCW0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

42.3 kDa

Amino Acid Sequence

MGTQALQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPCLFWDQTQQHSYSSASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPSCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRLAPATDCDQICFGHPGQLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASGSLLRAFDGARPPPSGPLRLGTAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEAPEGSAQTPAAPLDGANVSCSPRPGAPPAAIGGAVCWLREKGPRRWGLPGAPGEAGLCGTNSPEGWPCPAPPGTPRLRVLPRATGL

Validation Images & Assay Conditions

Gene/Protein Information For KREMEN2 (Source: Uniprot.org, NCBI)

Gene Name

KREMEN2

Full Name

Kremen protein 2

Weight

42.3 kDa

Alternative Names

Dickkopf receptor 2; kremen protein 2; Kremen2; Kremen-2; kringle containing transmembrane protein 2; Kringle domain-containing transmembrane protein 2; KRM2Kringle-containing protein marking the eye and the nose; MGC10791; MGC16709 Kremen2|2900054E04Rik, Krm, Krm2|kringle containing transmembrane protein 2|kremen protein 2|dickkopf receptor 2|kringle domain-containing transmembrane protein 2|kringle-containing protein marking the eye and the nose

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KREMEN2, check out the KREMEN2 Infographic

KREMEN2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KREMEN2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8NCW0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used KREMEN2 (NM_024507) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For KREMEN2 (NM_024507) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for KREMEN2 (NM_024507) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8NCW0
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.