KPNA4 (NM_002268) Human Recombinant Protein

Importin alpha 3/KPNA4 protein,

Recombinant protein of human karyopherin alpha 4 (importin alpha 3) (KPNA4)

Product Info Summary

SKU: PROTO00629
Size: 20 µg
Source: HEK293T

Product Name

KPNA4 (NM_002268) Human Recombinant Protein

View all Importin alpha 3/KPNA4 recombinant proteins

SKU/Catalog Number

PROTO00629

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human karyopherin alpha 4 (importin alpha 3) (KPNA4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

KPNA4 (NM_002268) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO00629)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

57.7 kDa

Amino Acid Sequence

MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF

Validation Images & Assay Conditions

Gene/Protein Information For KPNA4 (Source: Uniprot.org, NCBI)

Gene Name

KPNA4

Full Name

Importin subunit alpha-3

Weight

57.7 kDa

Superfamily

importin alpha family

Alternative Names

Importin alpha 3; Importin alpha Q1; importin subunit alpha-4; importin-alpha-Q1; IPOA3; karyopherin alpha 4 (importin alpha 3); KPNA4; MGC12217; MGC26703; Qip1; QIP12; QIP1Karyopherin subunit alpha-4; SRP3 KPNA4 IPOA3, QIP1, SRP3 karyopherin subunit alpha 4 importin subunit alpha-3|importin alpha Q1|importin subunit alpha-4|karyopherin alpha 4 (importin alpha 3)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KPNA4, check out the KPNA4 Infographic

KPNA4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KPNA4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO00629

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used KPNA4 (NM_002268) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For KPNA4 (NM_002268) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for KPNA4 (NM_002268) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO00629
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.