KIST (UHMK1) (NM_175866) Human Recombinant Protein

KIST protein,

Recombinant protein of human U2AF homology motif (UHM) kinase 1 (UHMK1)

Product Info Summary

SKU: PROTQ8TAS1
Size: 20 µg
Source: HEK293T

Product Name

KIST (UHMK1) (NM_175866) Human Recombinant Protein

View all KIST recombinant proteins

SKU/Catalog Number

PROTQ8TAS1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human U2AF homology motif (UHM) kinase 1 (UHMK1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

KIST (UHMK1) (NM_175866) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8TAS1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

46.4 kDa

Amino Acid Sequence

MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDLIKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL

Validation Images & Assay Conditions

Gene/Protein Information For Uhmk1 (Source: Uniprot.org, NCBI)

Gene Name

Uhmk1

Full Name

Serine/threonine-protein kinase Kist

Weight

46.4 kDa

Superfamily

protein kinase superfamily

Alternative Names

DKFZp434C1613; EC 2.7.11.1; FLJ23015; kinase interacting with leukemia-associated gene (stathmin); Kinase interacting with stathmin; KISKIS protein kinase; KIST; serine/threonine-protein kinase Kist; U2AF homology motif (UHM) kinase 1; U2AF homology motif kinase 1 Uhmk1|4732477C12Rik, 4930500M09Rik, AA673513, AI449218, AU021979, C820018A03Rik, K, KIS, Ki, Kist, P-CIP2|U2AF homology motif (UHM) kinase 1|serine/threonine-protein kinase Kist|PAM COOH-terminal interactor protein 2|U2AF homology motif kinase 1|kinase interacting with leukemia-associated gene (stathmin)|kinase interacting with stathmin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Uhmk1, check out the Uhmk1 Infographic

Uhmk1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Uhmk1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8TAS1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used KIST (UHMK1) (NM_175866) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For KIST (UHMK1) (NM_175866) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for KIST (UHMK1) (NM_175866) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8TAS1
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.