KCNJ9 (NM_004983) Human Recombinant Protein

Kir3.3 protein,

Recombinant protein of human potassium inwardly-rectifying channel, subfamily J, member 9 (KCNJ9)

Product Info Summary

SKU: PROTQ92806
Size: 20 µg
Source: HEK293T

Product Name

KCNJ9 (NM_004983) Human Recombinant Protein

View all Kir3.3 recombinant proteins

SKU/Catalog Number

PROTQ92806

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human potassium inwardly-rectifying channel, subfamily J, member 9 (KCNJ9)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

KCNJ9 (NM_004983) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ92806)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

43.8 kDa

Amino Acid Sequence

MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEKVEEEGAGEGAGGEAGADKEQNGCLPPPESESKV

Validation Images & Assay Conditions

Gene/Protein Information For KCNJ9 (Source: Uniprot.org, NCBI)

Gene Name

KCNJ9

Full Name

G protein-activated inward rectifier potassium channel 3

Weight

43.8 kDa

Superfamily

inward rectifier-type potassium channel (TC 1.A.2.1) family

Alternative Names

G protein-activated inward rectifier potassium channel 3; G protein-coupled inward rectifier potassium channel; GIRK-3; GIRK3KIR3.3; Inward rectifier K(+) channel Kir3.3; inwardly rectifier K+ channel KIR3.3; Kir3.3; Potassium channel, inwardly rectifying subfamily J member 9; potassium inwardly-rectifying channel, subfamily J, member 9 KCNJ9 GIRK3, KIR3.3 potassium inwardly rectifying channel subfamily J member 9 G protein-activated inward rectifier potassium channel 3|G protein-coupled inward rectifier potassium channel|inward rectifier K(+) channel Kir3.3|inwardly rectifier K+ channel KIR3.3|potassium channel, inwardly rectifying subfamily J member 9|potassium voltage-gated channel subfamily J member 9

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KCNJ9, check out the KCNJ9 Infographic

KCNJ9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KCNJ9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ92806

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used KCNJ9 (NM_004983) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For KCNJ9 (NM_004983) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for KCNJ9 (NM_004983) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ92806
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.